(data stored in ACNUC7421 zone)

EMBL: CP001958.PE554

CP001958.PE554       Location/Qualifiers
FT   CDS_pept        547146..550334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0565"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rop:ROP_64380
FT                   putative ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97047"
FT                   /db_xref="GOA:D6ZCK5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK5"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ADG97047.1"
FT                   /translation="MIGPRLLAQAIGAPVPSEEQEQVIGAPLASSAVLAGAGSGKTETV
FT                   AARVVWLIANGLVEPEHVLGLTFTRSAARGMLARVRARLAGFAASPLLERVDPTGRLGE
FT                   LLENSEPQVMTYDAYAGELVSRWGLLLGASATEAAAGGRVVLSEAGMWQLAYETVANWE
FT                   SLLSVDRGVAGVAEAVTALGRRMAEQLAAPDRVLAAAEELARLVRTLPKGPRQRAEPSL
FT                   ELREAVAVQQARAELLGVVARMQDRLRSSGAVDFATQTARAAELAQRFPQVRAEECAAH
FT                   RVVLLDEYQDTGHAQRILLRALFGPPRIGGAARGGGANGAAVTAVGDPHQAIYAWRGAS
FT                   SGNLAAFQADFGAPEALTLMTSWRNPASVLDLANLTAAPLRRAGIAVPELAARPDAPAG
FT                   EVRVALFDDAAAERAWIAERLRHAAQTSPTRPSMAVLVRRNADAVPVAEALTAAGLEAQ
FT                   VIGLGGLLATPQVAELVAMLELIADPGASAAALQVLTSPRWRIGARDLAALAQRAQELG
FT                   PGRARPLAPRDPAELVEQLTAVLADDGSERAGLGDALADLGDQGRYSAAGYARLALLAG
FT                   ELDRLRGQLARPLPEFVTLVERVTGLAVEADAQAKERLSAFASVVAEHAKAAELLGGSA
FT                   SLAGLVGYVRLAETVERGLPVGEVAPDPRKVQVLTVHAAKGLEWDVVAVAHLCAGVFPT
FT                   GRARSTWIGALAELPPEDLGPLTSSQDRAELQEMLRAEREAAKELAGEEERRLAYVAVT
FT                   RAKQTLLLSGHWLAEGAERALGPSAFLVEWRDALVAAGGSPDMWAESPALDHMRPASGE
FT                   SEGALWPPDPLLGRRAQTQRGAERVRAALADAVPLPRPEGPDAELYEAAAALVAERAAA
FT                   AEARSVERAGLTVSDVVGIAVDPAGFERERARRGPRPPAPEAQAGIGFHEWVRRWYLSE
FT                   ELVGLDELPGAADDDDAVASEKLRQKFLESPWAARSPVAVETPFELNLDGVLVRGRIDA
FT                   VFAEPGGGYVVVDWKTGRADLRRAKAQLSVYRLAWQRLTGAAQVAGAVHEVATGVTRTF
FT                   DDLYTAEELAALLR"
     atgatcggtc cgagattgct cgcccaagcg atcggcgcgc ctgtgccgag cgaggagcaa        60
     gagcaggtga tcggggcgcc gctcgcatcg tccgcggtgc tcgccggggc cgggtcgggc       120
     aagaccgaga ccgtcgcggc ccgggtggtg tggttgatcg ccaacggcct ggtggagccg       180
     gaacacgtgc tcggcctgac cttcacgaga tccgccgcgc ggggcatgct cgcccgggtc       240
     cgcgcgcggc tcgcgggctt cgcggcttcg ccgctcctgg agcgcgtcga ccccaccggg       300
     cgcctcgggg agcttttgga gaactccgag ccccaggtga tgacatatga cgcctatgcg       360
     ggggagctgg tctcgcgttg gggcttgctc ctgggggcaa gcgcgaccga agccgcggcg       420
     ggcgggcggg tcgtgttgtc cgaagcaggg atgtggcagt tggcgtacga gacggtcgcg       480
     aactgggagt cgttgctctc ggtggacagg ggcgtcgcag gcgtcgcgga ggcggtcacc       540
     gcgttgggca ggcggatggc ggagcagctc gccgctccgg accgggtcct cgccgccgcc       600
     gaggagctcg cgagactggt gcggacattg ccgaaagggc cgaggcagcg cgccgagccc       660
     tcgctcgaat tgcgcgaagc cgtggccgtg cagcaggctc gggcggaact gctgggcgtg       720
     gtcgcgcgga tgcaggaccg gttgcgttcg agcggggcgg tggacttcgc gacgcagaca       780
     gcgcgcgccg ccgaactcgc gcagcgattc ccccaggtcc gcgccgagga gtgcgcggcg       840
     caccgagtgg tgctgctcga cgagtaccag gacaccggcc atgcccaacg gatactgctg       900
     cgcgcgctgt tcggcccgcc ccgcatcggc ggggcagcgc ggggcggcgg ggcgaacggg       960
     gcagcagtga ccgcggtcgg cgacccgcac caggccattt acgcctggcg cggcgcgtcc      1020
     tcgggcaacc tcgcagcctt ccaagccgac ttcggagcac ctgaggcgct tacgctcatg      1080
     acaagttggc gcaaccccgc gtcggtgctc gacctcgcga acctcaccgc cgcgccgctg      1140
     cgccgcgccg ggatcgccgt ccccgaactc gccgcccgcc ccgacgcgcc cgccggcgag      1200
     gtgcgggtgg cgctgttcga cgacgcggcc gccgaacggg cctggatcgc ggagcgtctg      1260
     cgccacgcgg cacagacctc gccgacgagg ccttccatgg cggtgctggt ccgccgcaac      1320
     gccgacgcgg tgccggtcgc cgaggctctc acggcggcgg gccttgaggc gcaggtgatc      1380
     gggttgggcg ggttgctcgc caccccgcag gtcgccgaac tcgtggcgat gttggagctg      1440
     atcgccgacc ccggagcctc cgccgcggcg ttgcaggtgc tcacgagccc gaggtggcgg      1500
     atcggagccc gcgacctcgc cgcgctggcg caacgggcgc aggagctagg acctgggcgg      1560
     gcgcggccgc tcgccccccg cgatcctgcc gagctggtcg aacagctcac cgccgtgctc      1620
     gccgacgacg ggtctgaacg tgccgggttg ggcgacgccc tcgcggattt gggcgaccaa      1680
     gggcggtact ccgccgccgg atacgcgcgc ctcgccctgc tcgcaggcga actcgaccgc      1740
     ttgcgcggac agctcgcccg accgctgccg gagttcgtga ccttggtgga gcgcgtgacc      1800
     gggcttgccg tcgaagcgga cgcgcaggcg aaagaacggc tctcggcctt cgcgtcggtc      1860
     gtcgcagagc acgccaaagc cgccgagctg ctcggcggct cggcgagcct cgcgggcctc      1920
     gtcggctatg tgcgcctcgc cgagacggtc gagcgcgggc tgccggtcgg cgaggtcgcc      1980
     cccgaccccc gcaaggtgca ggtgttgacg gtccacgcgg ccaaaggcct ggaatgggac      2040
     gtcgtcgcgg tcgcgcacct ctgcgcagga gtgttcccga cgggccgggc ccgctccacc      2100
     tggatcggcg ccctcgccga gttgccgccc gaggacctcg gcccgttgac ctcgtcgcag      2160
     gaccgggcgg agctgcaaga gatgctgcgc gcggagcgcg aggcggccaa ggagctcgct      2220
     ggtgaggagg agcgccggct cgcgtatgtg gcggtgaccc gcgccaagca gaccctgctg      2280
     ctctccggcc attggctggc cgaaggggcc gagcgcgcgc tcggcccctc agcctttctc      2340
     gtcgagtggc gcgacgccct cgtcgccgca ggcggctcgc ccgacatgtg ggccgaatcg      2400
     cccgcgctcg accacatgcg tcctgcgtcc ggcgaatcag aaggcgcgct gtggccgccg      2460
     gaccccctcc tcggtcgtcg agcccagacg caacggggcg cggagcgtgt gcgggcggcg      2520
     ttggcggacg ccgtcccgct tccgcgacca gaaggccccg acgccgagct gtatgaggcc      2580
     gccgccgcgc ttgtcgccga acgcgccgcc gcggcagagg cgcgatcagt cgagcgggcc      2640
     gggctcaccg tcagcgatgt cgtcggcatc gctgtcgatc ccgccgggtt cgagcgcgag      2700
     cgcgcccggc gcggtccccg cccgcctgcg cccgaggcgc aggcggggat cggcttccac      2760
     gaatgggtgc gccgctggta cctctccgag gagcttgtcg gtttggacga gctgcccggc      2820
     gcggcggacg acgacgatgc ggtcgcgagc gaaaaattgc ggcagaaatt cctcgaatcg      2880
     ccctgggccg cgcgcagccc ggtggctgtg gagaccccgt tcgagctcaa cctcgacggg      2940
     gtgctggtgc gtgggcgcat cgacgcggtg ttcgccgagc caggcggcgg ttatgtggtg      3000
     gtggactgga agaccggccg ggccgatctc cgcagggcga aggcgcagtt gtcggtgtat      3060
     cggctcgcgt ggcagcggct caccggagcc gcgcaggtcg cgggcgcggt ccacgaggtg      3120
     gccaccgggg tgacgaggac cttcgacgat ctctacacag ctgaagagct cgcggcgctg      3180
     ctgcgctga                                                              3189
//

If you have problems or comments...

PBIL Back to PBIL home page