(data stored in ACNUC7421 zone)

EMBL: CP001958.PE557

CP001958.PE557       Location/Qualifiers
FT   CDS_pept        complement(551571..552830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0568"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmi:MMAR_0577 integral membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97050"
FT                   /db_xref="GOA:D6ZCK8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG97050.1"
FT                   /translation="MATDQPAPIGQKDQQPFPLGKLVLLSLCMLVVITVEVGPVGVLPH
FT                   IAADLRVPQSRAALLVSCYAITVVLASVPAIRLLDRFDRRQVLMLSMSAFAVSTAALAV
FT                   TRSLPLAVAARVIGGFGHAIFFGVGIDITHRLSPAKRMVPAVAIFFSGNVLALALAVPA
FT                   VAAAGGSGWRGTFLALAGSAGACVVAARLLLPALPSGKADAPPLAGGARRPFFPWPDRP
FT                   AATVCLFGLVWLTGHFLAFTLLRAELTAAGFPDRLAPALLMAYGIGTLAGTGLAGAVAT
FT                   HRLRGAIAVGFLLLCGAQLCLWSLLPSMWPSFAAAALWGIGFGAIPTLNSSAILHYSRV
FT                   SPDMTASMLSSACNIGISLGSFASGLVYQNLGHDSAFLLAAGIFVVGALATRSLHKDGP
FT                   REGLGLTRGARAEGPAQGPR"
     atggcaactg accagcccgc gcccatcggc cagaaggacc agcagccttt tccgctcggc        60
     aaactggtcc tcctttcgct gtgcatgctg gtggtcatca cagtggaagt gggcccggtc       120
     ggggtcctgc cgcacatcgc cgccgatctg cgggtcccgc aatcgcgcgc cgcgctcctc       180
     gtgagctgct acgcgatcac ggtggtcctc gcttccgtcc cggcgatccg gctgctcgac       240
     cgtttcgacc gcagacaggt gctcatgctt tcgatgagcg ctttcgcggt gtccaccgcg       300
     gccttggccg tcacccggag cttgccgctg gccgtcgccg cccgagtgat cggcggtttc       360
     ggccacgcga tcttcttcgg cgtcggcatc gacatcacgc accgcctgag cccggcgaaa       420
     cgcatggtgc ccgctgtcgc gatttttttc tccggcaatg tgctcgccct cgcgctcgcc       480
     gtgcccgccg tggcggccgc gggcggctcc ggctggcggg ggaccttctt ggcccttgcg       540
     ggcagcgcgg gagcgtgcgt ggtcgcagcc aggctgctcc tgcccgccct gccgtcgggg       600
     aaagccgacg ctcccccgct cgcaggaggc gcccgcagac cgttcttccc ctggcccgac       660
     cgccccgccg cgaccgtgtg ccttttcggc ctggtgtggc tcaccgggca ctttctcgcg       720
     ttcaccctgc tccgagccga actgaccgcg gcgggcttcc ccgaccgatt ggcgccggcc       780
     ctgctgatgg cgtacgggat cggcacgctc gccggaactg ggctggccgg ggccgtcgcg       840
     acgcaccggc tgcgcggcgc gatcgcggtg ggattcctgc tgctgtgcgg cgcgcagctc       900
     tgtctgtggt cgctgctccc ctcgatgtgg ccgtccttcg cggcggcggc gctgtggggg       960
     atcggcttcg gcgccattcc cacgctcaac tcgtccgcga tactgcatta ctcgcgggtc      1020
     tcgccggaca tgactgccag catgctgagt tccgcctgca acatagggat cagcctgggc      1080
     tccttcgcct cagggctggt gtatcaaaac ctcggccacg actcggcctt cctgctcgcc      1140
     gccgggatct tcgtcgtcgg cgcccttgcg acccgctcgc tgcacaagga cgggcctcgc      1200
     gaggggctgg ggctgacgcg aggggctagg gcagaggggc ctgcgcaggg gcctcggtga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page