(data stored in ACNUC7421 zone)

EMBL: CP001958.PE559

CP001958.PE559       Location/Qualifiers
FT   CDS_pept        554230..556203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0570"
FT                   /product="galactofuranosyltransferase"
FT                   /note="KEGG: rer:RER_02120 galactofuranosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97052"
FT                   /db_xref="GOA:D6ZCL0"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCL0"
FT                   /inference="similar to AA sequence:KEGG:RER_02120"
FT                   /protein_id="ADG97052.1"
FT                   /translation="MSQPEAAQQAAQTPPVGVGAPPTSSASGVRDETLLQRLVLPRAGE
FT                   SAGVRRLYVEHPNSATPRAHAIDRSRLRMRPDTEVSFATYFNAFPAAYWRRWTTLRSVV
FT                   LQVELSGRAGVQVYRSKSDAAPVLLESAVTSGGDQAQTLRFELPLTAFEDGGWMWFDVT
FT                   AEEEPVVLERASWHSPSEPPGGCGPEQSKVAIGIPTFNRPADAVQALLALTSDPVLDAR
FT                   VGAVVMVDQGTKKAKDEPGFAEAASRLGDRLTVHHQGNLGGSGGYARVMHEALTTTKAE
FT                   RFVVMDDDVDVEPESILRLIAFGRWAQTPTIVGGQMLNLQERSHLHSMGEVLDRVRLIW
FT                   EKAPNTRYDHDFARTPLLQTKQLHRRVDVEFNGWWLCLIPRKVLEDVGLPMPFFIKWDD
FT                   VELALRARKAGYPTVGLPGAAIWHMAWADKDDRIDWQSYFHLRNRLIVAALHHDGSRLG
FT                   LYFHLAKATLFHALTMEYSTLALQLKAVRDFKAGPEGLHGLLPKALGEAQSLRKNYPDA
FT                   HVIASATELPLPSGRDMGGTRKPLGRVGKVVRMATAVAHQLSKENPEHHERPQANVSSL
FT                   DAWWWMLSKVDGVTVTVGGGSGVVYRKRSRAEAVRLAKEFAREFVGLARDYSSLAKRYR
FT                   AAAPELTSEKTWLKTFGVKDGA"
     atgagccagc ccgaagcggc acagcaggcg gcgcagaccc cgcctgtcgg cgtgggggcg        60
     ccccccacga gttctgcgag tggggtgcga gacgaaacac tcctccaaag gctcgtcctg       120
     cctcgggcgg gggagtccgc aggggtgcgc aggctgtatg tggagcatcc caactccgcg       180
     acgccgaggg cgcacgcgat cgaccgttcc cggctgcgca tgcgcccgga caccgaggtc       240
     tctttcgcca cctacttcaa cgctttcccc gccgcgtact ggcggcgctg gacgactctt       300
     cgctcggtgg tgctgcaggt cgagctcagc ggccgggccg gggtccaggt ctatcggtcc       360
     aaatccgacg cggccccggt cctgttggaa tccgcggtca ccagcggcgg cgaccaggcg       420
     caaaccctgc gcttcgagct gccgctcacc gcgttcgagg acggcggctg gatgtggttc       480
     gacgtgaccg ccgaagagga accggtggtc ttggagcggg cgagctggca ttccccgtcc       540
     gaaccgccgg gcggctgtgg cccggagcag agcaaagtcg ccatcggcat tccgaccttc       600
     aaccggcccg ccgacgcggt gcaggccctc ctcgccctca ccagcgaccc cgtgctcgac       660
     gcgcgggtcg gggccgtggt catggtggac caggggacga agaaagccaa agacgagccg       720
     gggttcgccg aggccgcgtc ccggttgggc gatcgcctca cggtgcacca ccaaggaaac       780
     ctcggcggct ccggcggcta cgcccgcgtg atgcacgagg cgctcaccac gaccaaagca       840
     gagcgcttcg tggtcatgga cgacgacgtg gacgtggagc ccgagtcgat tctgcgcctc       900
     atcgcgttcg ggcgttgggc gcagaccccg accattgtcg gcggccaaat gctcaacctg       960
     caggagcgct cgcacctgca ctcgatgggc gaagtgctcg accgtgtgcg cctcatttgg      1020
     gagaaagccc ccaacacccg ctacgaccac gacttcgccc gcaccccgct cctgcagacc      1080
     aagcagctgc accggcgggt ggacgtggag ttcaacggct ggtggctgtg cctcatcccg      1140
     cgcaaagtgc tcgaagacgt cgggttgccg atgccgttct tcatcaaatg ggacgatgtg      1200
     gagctcgcgt tgcgcgcccg caaggcgggc tatcccacag tcggcctccc cggagccgcg      1260
     atctggcaca tggcctgggc ggacaaagac gaccggatcg actggcagtc gtacttccat      1320
     ttgcgcaacc ggctcatcgt cgccgcgctg caccacgacg gctcccgtct cggcctgtat      1380
     ttccacctcg cgaaggcgac gttgttccac gccctcacca tggagtactc gaccttggcg      1440
     ttgcagctca aagccgtccg ggacttcaaa gccggtcctg agggcttgca cgggctgctg      1500
     cccaaggccc tcggcgaggc ccaatcgctg cgcaagaact accccgacgc gcacgtcatc      1560
     gcctccgcaa ccgagctgcc gttgccgtcc ggccgcgaca tggggggcac ccgcaaaccg      1620
     ctcgggcgcg tcggcaaggt tgtgcggatg gccaccgccg tcgcccatca gctcagcaaa      1680
     gagaacccgg agcaccatga gcgcccgcag gccaacgtct cgtccctgga cgcctggtgg      1740
     tggatgctgt cgaaagtgga cggggtgacc gtcaccgtgg gcggcggatc tggcgtggtg      1800
     taccgcaagc gttccagggc ggaggcggtc cggctcgcca aagagttcgc ccgcgaattc      1860
     gtcggcctcg cccgcgacta cagttcgctc gcgaaacgct accgcgccgc agcgcccgag      1920
     ctcacaagcg aaaagacctg gctgaagact tttggcgtga aggatggagc atga            1974
//

If you have problems or comments...

PBIL Back to PBIL home page