(data stored in ACNUC7421 zone)

EMBL: CP001958.PE56

CP001958.PE56        Location/Qualifiers
FT   CDS_pept        41205..41459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aau:AAur_0477 putative
FT                   choline/carnitine/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96549"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96549.1"
FT                   /translation="MPSLDALRDEIDRAVTAYVAQSRAEDGDSPGLPGPWVVAVGSQSI
FT                   DDDGETIHTIEPVGQPGWVTKGLLLSTQELLRAEYQERE"
     atgcccagtc ttgacgctct gcgcgacgag atcgaccggg ccgtgaccgc gtatgtggcg        60
     cagtcccgcg cggaggacgg cgacagcccc ggtttgcccg gtccttgggt ggtggcggtg       120
     ggctcccagt cgatagacga cgacggcgag accatccaca ctatcgagcc tgtgggacag       180
     cccggatggg tcacgaaagg gcttctgctg tccacgcagg aactcttgcg ggccgagtac       240
     caggagcgcg aatga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page