(data stored in ACNUC7421 zone)

EMBL: CP001958.PE564

CP001958.PE564       Location/Qualifiers
FT   CDS_pept        complement(560293..561381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0575"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   dba:Dbac_1649 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97057"
FT                   /db_xref="GOA:D6ZCL5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCL5"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG97057.1"
FT                   /translation="MVSASAKPSSIAAQGAFLRPAVESDRGFLREIFTTALSDYYGGDH
FT                   VAHADRVLAAHLRGGEDRHGHFSQAQDTQILATPGADQLGVLNCALKRQGTVKISPLIV
FT                   SPRAKSGAGLGRTLLLHAQQFALRRRARQIYCTVAETNAKALGFFRRHGFVVAGSAQDQ
FT                   YKDGVRELVLYKDLRPQHGRRSWIIRECEENDLPAVVGMVCEFYAPILADQSKQVALSL
FT                   VDGFRRRSRRDLNEKFKDINLGLDENGSLLALAAAGPKKGAAVKVAPLCGRDMEVLSEL
FT                   VALVPDLFPSQRSRYYTHQIAEPDITKVMHKNGWRVDCLLPGAYRSDQCVVQWSLTLGC
FT                   SPDESRPQDLRRAAPDEKAELA"
     atggtgagcg catccgcgaa gccgtcttcc atcgccgctc aaggagcttt cctccgaccg        60
     gccgtcgaaa gcgaccgagg gttcctgcgg gaaatcttca caactgcctt gtccgactat       120
     tacggaggag accacgtcgc ccacgccgac cgcgtcctcg ccgcgcactt gcgcggcggg       180
     gaagaccggc acgggcattt ctcccaagcg caggacaccc agatcttggc cacgcccgga       240
     gccgaccagc tcggcgtcct caactgcgcg ctcaaacggc agggaacggt gaaaataagc       300
     ccgttgatcg tctcgccccg cgcgaaatcc ggcgcagggc tcggccggac gctgcttctg       360
     cacgcgcaac agttcgcgct gcggcgcaga gcccgccaaa tctactgcac cgtcgcagaa       420
     accaacgcca aagcgctcgg cttcttccgc cggcacgggt tcgtcgtcgc cggttcggcg       480
     caagaccagt acaaagacgg agttcgggaa ctcgtgctct acaaagacct ccggccacag       540
     cacggccgtc gatcatggat catccgcgag tgcgaggaaa acgacttgcc cgcggtcgtc       600
     ggcatggtct gcgaattcta cgccccgatc ttggccgacc agagcaagca ggtcgcgtta       660
     tccctggtgg acgggttccg caggcggagc cgacgcgacc tcaacgaaaa attcaaggac       720
     atcaatctcg gcctggacga gaacggctcc ttgctcgccc tggccgcggc aggccccaag       780
     aaaggagccg ccgtgaaggt cgccccgctc tgcggaagag acatggaagt tttgtccgaa       840
     ctcgtcgctc tcgtccccga cctcttcccc tcgcaacggt cgcgctacta cacccaccaa       900
     atcgcagaac cagacatcac caaggtcatg cacaagaacg gatggcgcgt ggactgtttg       960
     ctgcccggag cgtaccgctc ggaccaatgc gtcgtccaat ggtcgctcac gctcgggtgc      1020
     agccccgacg aatcgcgccc ccaggacctt cgccgggccg cgcccgacga gaaagccgaa      1080
     ctcgcatga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page