(data stored in ACNUC7421 zone)

EMBL: CP001958.PE571

CP001958.PE571       Location/Qualifiers
FT   CDS_pept        565817..566620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0582"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="KEGG: rer:RER_34430 imidazole glycerol phosphate
FT                   synthase subunit HisF; TIGRFAM: imidazoleglycerol phosphate
FT                   synthase, cyclase subunit; PFAM: histidine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97064"
FT                   /db_xref="GOA:D6ZCM2"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM2"
FT                   /inference="protein motif:TFAM:TIGR00735"
FT                   /protein_id="ADG97064.1"
FT                   /translation="MTLATRVIPCLDVDKGRVVKGVNFVDLRDAGDPVELAKAYDTVGA
FT                   DELCFLDITASSDERATTLDMVTRTAEQVFIPLTVGGGVRDVASADALLRAGADKVAVN
FT                   SAAVARPRLLSELAERWGAQCVVIAIDARRARPPEARSDRPGAAAGPSWSGFEVATHGG
FT                   RRGTGIDAVRWAREAVEFGAGEILLTSMDRDGTKSGFDLELIGAVRAVAPVPVIASGGA
FT                   GTAGHFAPAIHAGADAVLAASVFHFGEIAICEVKAAMAAEGIVVR"
     atgacgctcg ccacacgagt catcccctgc ctcgacgtcg acaagggcag ggtcgtcaaa        60
     ggcgtcaatt tcgtcgatct gcgcgacgcc ggggacccag tggagctggc gaaagcgtac       120
     gacacagtgg gggccgacga gctgtgcttc ctcgacatca ccgcctccag cgacgaacgg       180
     gcgaccaccc tcgacatggt gacccgcacc gctgagcagg tgttcatccc gctcaccgtc       240
     ggcggcgggg tccgcgacgt cgcgagcgcg gacgcgcttc tgcgcgccgg cgcggacaaa       300
     gtcgccgtca attcggcagc ggtcgcccgc ccccggctgc tgtccgagct cgccgagcgg       360
     tggggggcgc aatgcgtggt catcgctatc gacgctcggc gggcgcgccc gccggaggcg       420
     cgcagcgacc gccccggcgc ggcggccggt ccgtcctgga gcggcttcga agtcgccacg       480
     cacggtggtc ggcggggcac ggggatcgac gcggtgcggt gggcgcgcga ggcggtcgag       540
     ttcggagccg gtgaaatcct gctcacctcg atggaccgcg acggcacgaa gagcggcttc       600
     gacctggagc tgatcggcgc ggtgcgggcg gtcgcgccgg tccccgtgat cgcgtccggc       660
     ggggccggga cggccgggca tttcgccccc gcgatccacg ccggagcgga cgccgtgctc       720
     gcggcaagcg tttttcattt cggagagatc gcgatctgcg aggtcaaggc agcgatggcg       780
     gccgaaggta tcgtggtgcg atga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page