(data stored in ACNUC7421 zone)

EMBL: CP001958.PE577

CP001958.PE577       Location/Qualifiers
FT   CDS_pept        570512..571222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0588"
FT                   /product="Domain of unknown function DUF1906"
FT                   /note="PFAM: Domain of unknown function DUF1906; KEGG:
FT                   mav:MAV_1648 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97070"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM8"
FT                   /inference="protein motif:PFAM:PF08924"
FT                   /protein_id="ADG97070.1"
FT                   /translation="MTLDRRAVLRGAATLGVASALGLSAPRAHAAGGVLLDFAGAAPSP
FT                   AAIRGAGAIGTIRYVSDERNGPGKRSSKPVTRDQVQVSKAAGLVIVSCYQYGKNETADW
FT                   KGGQQAGLTHARRGVQLHLAAGGPAGAPIYACIDDDPSDAELQGPIRGYLLGWQQIVGP
FT                   NAVGVYGNPRTIDFCLRSGVGKWFWQHDYGNPGYRTHPAAHLHQRAASMQPQPVVGGTL
FT                   CDINDIIKPSFGAW"
     atgaccctcg accgacgcgc ggtgctgcgc ggcgccgcga cactgggcgt ggcttccgcc        60
     cttgggctct ccgccccgcg cgcgcacgcg gcgggcggcg tcttgttgga cttcgccggc       120
     gccgcgccca gcccggcggc gatccggggc gctggggcca tcgggacgat ccggtatgtg       180
     agcgacgagc gcaacggtcc agggaagcgg tcgtccaaac cggtcacccg cgaccaggtg       240
     caagtgtcga aagccgcagg cctcgtcatc gtctcctgct atcagtacgg caagaacgag       300
     accgcggatt ggaaaggcgg ccagcaagcc gggctcaccc acgcgcggcg cggagtgcag       360
     ctgcatcttg cggcgggcgg gcctgccggg gccccgattt acgcgtgcat cgacgacgac       420
     ccctccgacg cggaactgca agggccgatc cggggctacc tcctcggctg gcagcagatc       480
     gtcggcccca acgccgtcgg cgtctacggg aacccccgga ccatcgattt ctgcctgcgc       540
     tcgggggtgg ggaagtggtt ctggcagcac gactacggca accccggcta ccgcacgcat       600
     ccggcggcgc atctgcacca gcgagcggcc tcgatgcagc cccaaccagt ggtcggcgga       660
     accctctgcg atatcaacga catcatcaaa ccgtcattcg gcgcctggtg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page