(data stored in ACNUC7421 zone)

EMBL: CP001958.PE579

CP001958.PE579       Location/Qualifiers
FT   CDS_pept        complement(571628..572197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0590"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbt:JTY_3961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97072"
FT                   /db_xref="InterPro:IPR028953"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97072.1"
FT                   /translation="MTDAQSLALSDRFLAWLARAGWAASRWNDDGSFDEQGDCSIWEED
FT                   QGGRVLTAYLLHRRESDGWVEVAKGSAERLVFAASGLAAVERYFWGLLADAVRERLGLR
FT                   ELQARTDIASGYRIEDGLRDAAGRLVAKGEQQSLVALSRSLAPTLDQLETSLLDPEGKP
FT                   LFAVRDATARAETAAILPAPGQPRGA"
     atgacggacg cgcagagcct ggccctttcc gacaggttcc tggcctggct cgcacgggcg        60
     gggtgggcgg cgagccgctg gaacgacgac gggtccttcg acgagcaggg ggactgctcg       120
     atctgggagg aagaccaggg gggccgggtc ctgacggcgt acctgctgca tcgccgggag       180
     agcgacggct gggtcgaggt cgccaagggc agcgccgagc gcctcgtctt cgcggcgagc       240
     ggcctcgccg cagtggaacg gtatttctgg ggcctgctcg ccgacgcggt gcgcgaacgg       300
     ctcggcctgc gggaacttca ggcgcggacg gacatcgcca gcggctaccg gatcgaagac       360
     gggttgcggg acgctgccgg gcggcttgtg gccaagggcg agcagcagag cctcgtcgcc       420
     ctgtcccgct ctctcgcccc gacgctcgac cagctggaaa cctcattgct cgacccggag       480
     ggcaaaccgc tcttcgcggt gcgggatgcg accgcgcggg ctgagaccgc agcaatcctt       540
     cccgctcctg gtcagccgcg cggcgcgtga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page