(data stored in ACNUC7421 zone)

EMBL: CP001958.PE587

CP001958.PE587       Location/Qualifiers
FT   CDS_pept        578582..579643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0598"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: AMP dependent CoA ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97080"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97080.1"
FT                   /translation="MKSGLHRRRDGANAAPHKSTRVSKLLTSFLAVSGLIVCLGGCDYP
FT                   DRRSEANSVGATVRALPGVASADVRYDTSFDGGAHFDLDVKLADNASAAQAAAMGRVFV
FT                   DRMRASELDQFDVTLNVQYRFTSSTANEPARGSSATLKFNERANPPNGPSGAETSDSLA
FT                   LWLTVAQSPFFFGVGMTQPTFEGPDSSRDMFIELPFDTDDATISDFIHEHPGLDTATWV
FT                   TTIPDWEAGLRPAAYKLRGEFPDKHRRELWKKLLKQLGASDKIDLEIDAIKAPAGRAPV
FT                   YLEIIDHSSKEKVPQVARSVAAAALGFGDIVDLRFGSEYGRIELVEGVCEQPQPSKLLA
FT                   DLENELRQQYKHC"
     atgaaatcgg gcctgcatag gaggcgggac ggggctaacg cggcccctca caagagcacg        60
     agggtgtcga aactgttgac atcgttcctc gcggtctcgg ggctcatcgt ctgcttgggc       120
     ggctgcgact acccagaccg gcgctcggag gcgaactccg taggggcaac cgtgcgcgca       180
     ctgccgggcg ttgcctcagc tgatgtccgc tatgacacga gtttcgacgg cggtgcgcac       240
     ttcgacctgg acgtaaaact tgcagacaat gcctccgccg cgcaggcggc ggcaatgggg       300
     agagtgttcg tggatcgaat gagagcctcc gagctcgacc aattcgatgt cactctcaac       360
     gtccagtata ggtttacgag cagcaccgcc aacgaaccgg cacgaggctc ttcggcaact       420
     ctcaaattca acgagcgcgc gaaccctcca aacggtccct cgggcgcgga aacgtccgac       480
     agcctggcct tgtggttaac ggtcgcccaa tcaccttttt tctttggtgt cggcatgacc       540
     caacccacct tcgagggacc agactcctcc agagacatgt tcatcgagct acctttcgat       600
     acagacgacg cgaccatttc cgacttcatc catgagcacc ccggcctaga cacggccact       660
     tgggtcacga caatcccgga ctgggaagcg ggcctgcgcc ctgccgccta caaattacgt       720
     ggcgaattcc ccgacaagca ccggcgcgag ctatggaaaa aactcctcaa acaactcggc       780
     gccagcgaca agatcgactt agagatcgac gcgatcaaag ctcctgctgg ccgcgcgccc       840
     gtctaccttg aaatcattga tcacagctcg aaagaaaagg ttcctcaggt cgcgcgctca       900
     gtcgcggcgg ccgccctcgg gttcggggac atcgttgatc tcaggttcgg ctcagagtac       960
     gggcggatcg agctcgtcga aggcgtatgt gagcagcccc agccttcgaa acttctcgcc      1020
     gatctagaga acgagctgcg tcagcagtac aagcactgct ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page