(data stored in ACNUC7421 zone)

EMBL: CP001958.PE590

CP001958.PE590       Location/Qualifiers
FT   CDS_pept        complement(581100..581411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_16880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97083"
FT                   /db_xref="InterPro:IPR021784"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP1"
FT                   /inference="similar to AA sequence:KEGG:RER_16880"
FT                   /protein_id="ADG97083.1"
FT                   /translation="MSLPPTLRAIVQWLRAAYPQGIPEQDYVPLFALMPRKLSEGEIRQ
FT                   LAETLNENGRGAASSIDIGVLITKITNELPRAEDVDRIRQRLGDLVWEDEDGSGKTGA"
     atgtcacttc ctccgacgct cagagcgatc gtgcagtggc tgcgggccgc ctacccccaa        60
     ggaattccgg agcaagacta cgtcccgctc ttcgcgctca tgccgcgcaa actctccgaa       120
     ggggagatcc gccagctcgc ggaaacactc aacgagaacg ggcgcggcgc agcgtccagc       180
     atcgacatcg gcgtgctcat cacgaaaatc acgaacgagt tgcccagggc ggaggacgtc       240
     gaccgcatcc gccagcgcct cggcgacctg gtgtgggaag acgaggacgg atccggcaag       300
     accggtgcct ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page