(data stored in ACNUC7421 zone)

EMBL: CP001958.PE591

CP001958.PE591       Location/Qualifiers
FT   CDS_pept        complement(581481..581768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: krh:KRH_23050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97084"
FT                   /db_xref="GOA:D6ZCP2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP2"
FT                   /inference="similar to AA sequence:KEGG:KRH_23050"
FT                   /protein_id="ADG97084.1"
FT                   /translation="MNQFNADYFLGVGKAVITVLIVGVIFGAGLPALFAAGLTSLYGGE
FT                   PETAGTVAATKNPARVALAWLAFAAVLALIAFGIAVIVFGKPLLHAVGLV"
     gtgaaccagt tcaacgctga ctattttctc ggcgtcggca aagccgtcat cacggtgctg        60
     atcgtcggcg tcattttcgg cgccggtctg ccagccttgt tcgccgcggg gctcaccagc       120
     ctctacggcg gcgagccgga aaccgccggc acggtcgcgg cgacgaagaa cccggcgcgg       180
     gtcgccctcg cctggcttgc cttcgccgcc gtcctcgccc tgatcgcctt cgggatcgcc       240
     gtgatcgtct tcggcaagcc cctgctgcac gctgtgggtt tggtctag                    288
//

If you have problems or comments...

PBIL Back to PBIL home page