(data stored in ACNUC7421 zone)

EMBL: CP001958.PE593

CP001958.PE593       Location/Qualifiers
FT   CDS_pept        complement(583159..583557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0604"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rer:RER_16970 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97086"
FT                   /db_xref="GOA:D6ZCP4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP4"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADG97086.1"
FT                   /translation="MDVLASKFILYPSDYEGSLRFYRDVLGLAVFREYPGGTVFFAGGG
FT                   LIELAGHGESAPPEPGKASAVYLQVRDVYAAERELRAAGAEIEREAKQEPWGLHELRVR
FT                   DPQGTLLILAHVPEDHPQRRAGKPPAQP"
     atggacgttt tggcgagcaa gttcattctg tacccctccg attacgaggg gtcgctgcgg        60
     ttctaccggg acgtgctcgg cctcgcggtc tttcgcgagt accccggcgg gacggtgttc       120
     ttcgccgggg gcgggctgat cgagctcgcg ggccacggcg agagcgcccc gcccgagccg       180
     ggcaaagcgt ccgcggtcta cctccaggtg cgcgacgtgt acgccgccga gcgcgagttg       240
     cgcgccgccg gggccgagat cgagcgcgag gcgaagcagg agccgtgggg gctgcacgaa       300
     ttgcgcgtcc gcgacccgca aggcacgttg ttgatcttgg cgcacgttcc ggaggaccac       360
     ccgcagcgca gggccgggaa gcctccggcg cagccgtga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page