(data stored in ACNUC7421 zone)

EMBL: CP001958.PE594

CP001958.PE594       Location/Qualifiers
FT   CDS_pept        complement(583574..584845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0605"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG: sma:SAV_2294
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97087"
FT                   /db_xref="GOA:D6ZCP5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP5"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADG97087.1"
FT                   /translation="MHDLDVLLTPEAAAKLARRGYQLDIARLESLREQRKALRRQADEL
FT                   RAQVRALGKAGKDAVDKQAHAEHARAVKEQVRETEAALDELEAALRAELLTIPNLPSDA
FT                   APEGLRESDYQIVRVVGEQQTFDPAEYPDGPKDHVALGEQLGILDLGRAVKLSGPRFSF
FT                   LKGQGARLERALASFFLDLHTREHGYEEFSVPLIVGAQTLTGSGQLPKFGEDLFKIATG
FT                   EPQYLIPTAEVPLVNYYAGEFLGADALPIAATAHSSCFRSEAGSYGRDTKGILRQHQFS
FT                   KVELVRVVLPEHAQAQQELMLGHAERCLRELGLHYRVIDLPAGDLGFTAERTFDIEAWL
FT                   PSQNAYREISSVSSCADFQSRRNGLRVKGKDGERIWPATLNGSALPIGRTVIAILEQFQ
FT                   QPDGSVLVPEALRGFMGADALRPV"
     atgcacgacc tcgacgtcct cctgaccccg gaagccgccg cgaagctcgc caggcgcggc        60
     taccagctcg acatcgcgcg tttggagtct cttcgcgaac agcgcaaggc cctgcgccgc       120
     caggccgacg agctgcgcgc gcaagtgcgg gccctgggca aagcgggcaa ggacgcggtg       180
     gacaaacaag cgcacgccga acacgcccgc gcggtgaaag agcaggtgcg cgagaccgag       240
     gccgccctcg acgagctgga ggcagcgctg cgagcggaac tgctgacgat cccgaacctg       300
     ccctcggacg cggctccgga agggctgcgc gagtcggact accagatcgt ccgcgtggtc       360
     ggcgaacagc agacgttcga ccccgccgag tacccggacg gcccgaagga ccacgtcgcg       420
     ctgggcgaac agctgggcat cctcgacctg gggcgggcgg tgaagctctc cggccccagg       480
     ttcagcttcc tcaaaggcca gggcgcgcgg ctggaacggg cgctggcctc gttcttcctg       540
     gacctgcaca cccgggagca cggctacgag gagttctccg tgccgctcat cgtgggcgcg       600
     cagacgctca ccggctcggg acaactgccg aaattcggcg aagacctgtt caagatcgcc       660
     accggcgagc cgcagtattt gatcccgacc gcggaagtgc cgctggtgaa ctactacgcg       720
     ggggagttcc tcggcgccga cgcgctgccc atcgccgcga ccgcgcattc gagctgtttc       780
     cgctcggagg caggctcgta cggcagggac accaagggca ttctgcgcca gcaccagttc       840
     agcaaagtgg agctggtgcg ggtcgtgctc ccggagcacg cccaggcgca gcaggagctg       900
     atgctcggcc acgccgagcg gtgcctgcgc gagctgggtt tgcactaccg ggtgatcgac       960
     ctgcccgcgg gcgacctcgg tttcaccgcc gaacggacct tcgacatcga ggcgtggctg      1020
     cccagccaaa acgcctaccg cgagatctcc agcgtgtcca gttgcgccga cttccaaagc      1080
     cgccgcaacg ggctgcgcgt gaaaggcaag gacggcgagc ggatctggcc tgcgacgctc      1140
     aacggctcgg cgctgccgat cgggcgcacg gtcatcgcga tccttgagca gttccagcag      1200
     ccggacggca gcgtcctcgt gccggaggcc ttgcgcgggt tcatgggcgc ggacgcgctg      1260
     cgcccggtct ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page