(data stored in ACNUC7421 zone)

EMBL: CP001958.PE595

CP001958.PE595       Location/Qualifiers
FT   CDS_pept        584921..586579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0606"
FT                   /product="2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid
FT                   synthase"
FT                   /note="KEGG: gbr:Gbro_1092 2-succinyl-5-enolpyruvyl-6-
FT                   hydroxy-3-cyclohexene -1-carboxylic-acidsynthase; PFAM:
FT                   thiamine pyrophosphate protein TPP binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97088"
FT                   /db_xref="GOA:D6ZCP6"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP6"
FT                   /inference="protein motif:PRIAM:2.2.1.9"
FT                   /protein_id="ADG97088.1"
FT                   /translation="MNPSTLQARVLVDEFLRGGVREAVLCPGSRNAPLSFALHAAERAG
FT                   RVRLHVRIDERSAGFLAVGLAAASGAPVIVVMTSGTAVANLGPAVCEANYARVPLIVLS
FT                   ANRPYEVLGSGVNQVIEQLGLFGSQVREAVSAGLAEQAATSGSQWRARVVRALSAATGT
FT                   RTGNAGPVQFDVPFREPLVPQAPEDDLESHCGGAFAGRPGGGPWTQIPQGGFEIPTPID
FT                   LSVPTVVVSGHGAGSHPELAALPTVAEPTAPVPANPLHPFAVPHVGAEQAVICGRPTLH
FT                   RQVASLLADPAVRVYALTTGPRWPDVAGNVAGTGTRAVPVGSPDPAWLQRCARAHAAAL
FT                   GSVGRGLDAEAATTGLHVARAVLAALRPGDQLVLGASNPVRDVALAGGVPAGVAVRSNR
FT                   GVSGIDGVLSSAVGSALAHEGRTIALLGDLTFLHDVSGLVIGPHEPKPRSLAIVVANDD
FT                   GGGIFELLEQGGPEYRAEAYGDAYERLFGTPHGKDFSALCAGLGVAHVRAALDELPAAL
FT                   GAEAEGLRVVEVRTDRGALRDLHRAMREFDLGEAR"
     atgaacccgt ccacattgca agcgcgggtg ctggtcgacg agttcctgcg cggcggggtc        60
     cgcgaggcgg tgctgtgccc gggctcgcgc aacgcgccgt tgtccttcgc cctgcacgcc       120
     gccgaacgcg ccgggcgggt ccggctgcat gtgcgcatcg acgagcgctc cgcggggttc       180
     ctcgcggtcg gcctcgcggc ggcttcgggg gctccggtca tcgtggtgat gacgtcgggg       240
     acggcggtgg ccaatctcgg gcctgccgtc tgcgaggcca actacgcgcg cgtgccgctc       300
     atcgtgctca gcgccaaccg gccgtacgaa gtgctcggct ccggggtcaa ccaggtgatc       360
     gagcagctgg gcctgttcgg ctcccaagtg cgcgaggcgg tttccgccgg gctcgccgag       420
     caagcggcga cgtccggcag ccaatggcgg gcccgcgtgg tccgggcgtt gtcggcggcc       480
     acgggcacgc gcaccggcaa cgcggggccg gtccaattcg acgtgccgtt ccgcgagccc       540
     ctcgtgccgc aggcccccga ggacgacttg gaaagccact gcggcggggc gttcgcgggc       600
     aggcccggcg gcgggccgtg gacgcagatc ccccagggcg ggttcgagat ccccaccccg       660
     atcgacctgt ccgtgccgac cgtggtcgtc tccggccacg gggcgggctc gcatcccgag       720
     ctcgccgcgc tccccacggt cgccgagccg accgcgccgg taccggccaa tccgttgcac       780
     ccgttcgccg tgccccacgt cggggccgaa caagcggtca tctgcgggcg cccgaccctg       840
     caccgccagg tcgcctcctt gctcgccgac cccgccgtgc gggtctacgc gctgaccacc       900
     gggccgcgct ggcccgatgt ggcgggcaac gtcgcgggca ccggcacgcg cgccgtcccg       960
     gtcggctccc cggacccggc gtggctgcag cgctgcgcgc gggcgcacgc cgcggctctc      1020
     ggctcggtcg gccgagggct cgacgccgag gcggccacga ctggcctgca tgtggcccgc      1080
     gccgtgctcg cggccctgcg gccgggggac cagctcgtgc tcggggcctc caacccggtc      1140
     cgggacgtcg cgctcgcggg cggcgtcccc gccggggtcg cggtgcgctc caaccgaggc      1200
     gtttcgggga tcgacggggt gctctcctcc gcggtcggct ccgcgttggc ccacgagggc      1260
     cgcaccatcg ccctgctcgg cgacctcacc ttcctgcacg acgtctcggg tttggtgatc      1320
     gggccgcacg agccgaagcc tcgctcgctc gccattgtcg tggcgaacga cgacggcggg      1380
     gggatcttcg agcttctgga acagggcggg ccggagtatc gggccgaagc gtacggggac      1440
     gcctacgagc gtcttttcgg caccccgcac gggaaagact tctccgcgtt gtgcgcgggc      1500
     ttgggcgtgg cgcacgtccg ggcggcgctg gacgagctgc ccgcggcgct cggcgctgag      1560
     gccgagggtc tgcgcgtggt cgaagtcagg accgaccggg gcgcgcttcg cgatctgcac      1620
     cgggccatgc gcgagttcga cctcggcgag gcccggtga                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page