(data stored in ACNUC7421 zone)

EMBL: CP001958.PE60

CP001958.PE60        Location/Qualifiers
FT   CDS_pept        42807..43085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0060"
FT                   /product="HNH endonuclease"
FT                   /note="KEGG: snm:SP70585_0056 HNH endonuclease domain
FT                   protein; PFAM: HNH endonuclease; SMART: HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96553"
FT                   /db_xref="GOA:D6Z9M6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M6"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADG96553.1"
FT                   /translation="MGVPRSTTKRDADRKTIARGKPPCGICGGEIDYALPHTDPASFVA
FT                   DHIVPLNKGGADVLANKQPAHRDCNRAKSDTAVTDLRRRYVTERAWA"
     atgggcgtcc cgcgcagcac gaccaagcgg gatgccgacc gcaagaccat cgccaggggc        60
     aaaccgccgt gcggtatctg cggcggggag atcgactatg ccctgccgca caccgacccc       120
     gcctcgttcg tcgccgacca catcgtgccc ttgaacaagg gcggcgctga tgtgctcgcg       180
     aacaagcagc ccgcgcaccg ggactgcaac agggccaaga gcgacaccgc tgtcaccgac       240
     ctcagacggc ggtacgtcac agagagagcg tgggcatga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page