(data stored in ACNUC7421 zone)

EMBL: CP001958.PE604

CP001958.PE604       Location/Qualifiers
FT   CDS_pept        596086..597288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0615"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: bpy:Bphyt_4926 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97097"
FT                   /db_xref="GOA:D6ZCQ5"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ5"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ADG97097.1"
FT                   /translation="MRVRSACAAILCAALLLAGLPSAAARAALVDSEPQKIIIIDTDFA
FT                   TMLDDGQVVSMAAQLHAEGQIDLLGVTVVTGDEWRDQEVAEAVRATERLGVGDPGPCRR
FT                   VPADFAVGVYPGADYPLDHGPAAVKADAAALATGDGFTGAWGTKKPVSRADLVAPPDGF
FT                   ATCARPRAQRAVDFMADQLRAFPHEITIVAIGPLTDLALLAKEHPDAVGLVKRIVIMGG
FT                   AFDVPGNSTAKAELNWWFDPKAADEVLKLPVEEVVTPLDLSNTVPLDDALYRRIAFPPS
FT                   PTPVTGLYRDIVGAGLDGKGGFDRDPDYTQPLWDELAFAYAVDPGFATESRVVWPTVRA
FT                   QLGENDGSVSYAPAPKPGRRPVTVITKFDNPRFDDWYVDLMTRPVPVRRQGASRLAQGN
FT                   H"
     gtgagggttc ggagcgcctg cgcggcgatc ctctgcgccg ctctgctcct cgcgggtctg        60
     ccgtccgccg ccgcgcgggc cgcgctcgtg gactccgagc cgcagaagat catcatcatc       120
     gacaccgact tcgccaccat gctggacgac gggcaagtgg tgtcgatggc cgcgcagctg       180
     cacgccgagg ggcagatcga cctgctcggc gtcaccgtgg tcaccggcga cgagtggcgc       240
     gaccaggagg tcgccgaggc agtcagggcg accgagcggc ttggcgtcgg cgacccgggg       300
     ccttgtcggc gcgttccggc ggacttcgcg gtcggggtgt atccgggcgc ggactacccc       360
     ctcgaccacg ggcccgcggc cgtcaaagcc gacgcggcgg cgctcgcgac cggggacggc       420
     ttcaccgggg cgtggggcac gaagaagccg gtgtcgcggg cggacctcgt ggcgccgccg       480
     gacggattcg cgacgtgcgc gaggccgcgc gcccagcggg ccgtcgattt catggcggac       540
     cagctgcgcg ccttcccgca cgagatcacg attgtcgcca tcgggccgtt gaccgacctg       600
     gccctgttgg ccaaggagca tccggacgcg gtcgggctcg tcaaacggat cgtcatcatg       660
     ggcggggcgt tcgacgtgcc ggggaactcc acggcgaagg cggagctgaa ctggtggttc       720
     gacccgaaag ctgcggacga ggtgctgaag ctgccggtcg aagaagtcgt gaccccgttg       780
     gacttgagca acaccgtgcc cctcgacgac gcgctgtacc ggcgcatcgc gttcccgccg       840
     agcccgacgc ccgtcaccgg cctgtaccgc gacatcgtcg gagccggtct cgacggcaag       900
     ggcggctttg accgggaccc ggactacacc cagccgctct gggacgagct ggcgttcgcg       960
     tacgccgtcg atccgggttt cgccaccgag tcccgcgtgg tgtggccgac ggtgcgcgcc      1020
     cagctcggcg aaaacgacgg cagcgtgtcc tacgcccctg ccccgaagcc ggggcggcgc      1080
     ccggtgactg tcatcaccaa attcgacaac ccgcgctttg acgactggta tgtggacctc      1140
     atgaccaggc ccgtgcccgt gagaaggcag ggggcgtcgc gcctggctca gggaaaccac      1200
     tag                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page