(data stored in ACNUC7421 zone)

EMBL: CP001958.PE605

CP001958.PE605       Location/Qualifiers
FT   CDS_pept        597336..598352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0616"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase,
FT                   type I; KEGG: nfa:nfa35890 glyceraldehyde-3-phosphate
FT                   dehydrogenase; PFAM: Glyceraldehyde 3-phosphate
FT                   dehydrogenase, NAD(P) binding domain; Glyceraldehyde
FT                   3-phosphate dehydrogenase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97098"
FT                   /db_xref="GOA:D6ZCQ6"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ6"
FT                   /inference="protein motif:TFAM:TIGR01534"
FT                   /protein_id="ADG97098.1"
FT                   /translation="MAIRVGVNGFGRIGRNFFRAAHAAKAAGRADFEIVAVNDLSDPAN
FT                   LAHLLKYDSILRRFPEEVSVDGQDILVGSQKIRALAVKEGPAALPWGDLGVDVVVESTG
FT                   IFTDAAKAKGHLDAGAKKVVISAPATGEDLTVVLGANEDKYDGSQKIISNASCTTNSIA
FT                   PVLKVIDEAFGIVRGGLTTVHAYTQDQNLQDGPHKDLRRARAAALNIVPTSTGAAKAIG
FT                   LVLPQLVGKLDGYALRVPTPTGSISDLTLDVEKEATADAVNAAVKAAAEGPLQGILKYS
FT                   TDPIVSGDIIGDPHSSIFDAPLTKVISGQIKVAAWYDNEWGYSSRLVDLITLIGKSL"
     gtggctattc gagtaggcgt caacggtttc ggacggatcg gccggaactt cttccgggcg        60
     gcgcacgcgg cgaaagcggc cgggcgggcg gacttcgaga tcgtcgcggt caacgacctg       120
     agcgatcccg cgaacctcgc ccacctgttg aaatacgact ccatcctgcg ccgcttcccc       180
     gaggaggtct cggtcgacgg ccaggacatc ctcgtcggca gccagaagat ccgcgccctc       240
     gcggtcaagg agggccccgc agccctgccc tggggcgatt tgggcgtcga cgtggtcgtc       300
     gagtccaccg gcatcttcac cgacgccgcg aaggcgaagg gccacctcga cgccggcgcg       360
     aagaaggtcg tcatctccgc tcccgccacc ggcgaggacc tgacggtcgt gctcggtgcc       420
     aacgaggaca agtacgacgg cagccagaag atcatctcca acgcttcctg caccacgaac       480
     tccatcgccc cggtgctcaa ggtgatcgac gaggcgttcg gcatcgtccg gggcgggctc       540
     accaccgtgc acgcgtacac ccaggaccag aacctgcagg acggcccgca caaggacctg       600
     cgccgcgccc gcgccgccgc gctcaacatc gtcccgacct cgaccggggc ggcgaaggcc       660
     atcggcctcg tgctgccgca gctggtgggc aagctcgacg gctacgccct gcgcgtgccc       720
     acgccgaccg ggtcgatctc cgacctcacg ttggacgtcg agaaggaggc caccgccgac       780
     gcggtgaacg cggcggtgaa ggccgccgcg gaggggccgt tgcagggcat cctcaagtac       840
     tcgaccgacc cgatcgtctc cggcgacatc atcggcgacc cgcattcgag catcttcgac       900
     gcgccgctca ccaaggtcat ctccggccag atcaaggtcg cggcctggta tgacaacgaa       960
     tggggctact cctccaggct cgtggacctc atcacgctga tcggcaagtc cctctaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page