(data stored in ACNUC7421 zone)

EMBL: CP001958.PE612

CP001958.PE612       Location/Qualifiers
FT   CDS_pept        605192..605527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0623"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_5896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97105"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97105.1"
FT                   /translation="MVTHCPCVAEERENMGFDINPDGIRGNADSLRGICEQFGSIGESG
FT                   KNTELGWDVFGLLGRPFAWGLGYATKAAGSGIEAYGQIIGHTAEQLDHAADHIAARDQE
FT                   ASDYLAQ"
     atggtgacgc actgcccgtg cgtcgccgaa gaaagggaga atatgggctt cgacatcaac        60
     ccggacggca tccggggcaa cgcggacagc ctgcggggca tctgtgaaca gttcggctcc       120
     atcggcgaat cgggcaagaa caccgagctc ggctgggatg tgttcggcct cctcggcagg       180
     ccgttcgcct gggggctcgg ctacgcgacc aaagctgccg gaagcggcat cgaggcgtac       240
     gggcagatca tcggccacac cgccgagcag ctcgaccacg ccgccgatca catcgccgcg       300
     cgcgatcaag aggcctcgga ctacctggcg cagtga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page