(data stored in ACNUC7421 zone)

EMBL: CP001958.PE617

CP001958.PE617       Location/Qualifiers
FT   CDS_pept        complement(609418..609990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0628"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_1343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97110"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97110.1"
FT                   /translation="MTARPSHSPQASNTQRRKHARQTGPGQPVQSTGLAGRATRRANRR
FT                   GRDLRGDLVPQQLPAWRSKREKFDSLVLEALSPIDQRWHDHLVGLDIAVDEVPRMHPLH
FT                   QQFVQWPPEVTADGPVPLARLIPAGVDVSGRHTRARVVLFRRPLEDRAEDPDELVDLLH
FT                   HVLVRQIATYLGLTEEAIDPEGTTYDY"
     atgacggctc gaccttcgca cagccctcaa gcttccaaca cccagcgccg caagcacgcg        60
     cggcagaccg gtccgggaca gcccgtccag agcacgggcc tcgcggggcg cgcgacccga       120
     cgggccaacc gcagggggcg cgatctgcgc ggcgacctgg tgccgcagca gcttcccgca       180
     tggcgcagca aacgggagaa gttcgactcg ctcgtcctcg aagcgctctc ccccatcgac       240
     cagcgctggc acgaccacct cgtcgggctg gacatcgcgg tggacgaggt cccccggatg       300
     catccgttgc accagcagtt cgtgcaatgg ccccccgagg tgacagcgga cggccccgtg       360
     cccctcgccc ggctcattcc ggcgggagtc gacgtctccg gccgccacac gcgggctcgc       420
     gtggtgttgt tccgcagacc gctggaggac cgggccgagg acccggacga actcgtcgac       480
     ctgctccatc acgttttggt gcgccagatt gcgacatatc tcgggctgac cgaagaggcg       540
     atcgaccccg agggcaccac gtacgactat tag                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page