(data stored in ACNUC7421 zone)

EMBL: CP001958.PE68

CP001958.PE68        Location/Qualifiers
FT   CDS_pept        48841..49308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cur:cur_1418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96561"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9N4"
FT                   /inference="similar to AA sequence:KEGG:cur_1418"
FT                   /protein_id="ADG96561.1"
FT                   /translation="MPAVTITPADLAPFAVIEEPKALAMIADALAMARLVAPCVDKDDF
FT                   PFADAAKAVIRGAILRWEESGSGAISQQTAGPFGQTLDTRSPRRGMFLPSEIEQLQKMC
FT                   RNASSSGAFSIDTAPNGGGVWHDDACNLAFGASWCSCGANLTGDGPLWGTA"
     atgccagcgg tgacgataac cccagctgat ctcgcgccgt tcgcggtgat cgaggagccg        60
     aaggctttgg cgatgatcgc ggacgcgctg gcgatggcgc ggttggtcgc tccctgtgtt       120
     gacaaggacg atttcccgtt cgcggacgcc gccaaggcgg tgatccgtgg cgcgatcctg       180
     cggtgggagg agtccggctc cggtgcgatc tcgcagcaga cggcggggcc gttcgggcag       240
     acgctcgaca cccgatcccc gcgccggggc atgttcttgc ccagcgagat cgagcagttg       300
     cagaagatgt gccgcaacgc ttcaagctcg ggggctttct ccatcgacac ggccccgaac       360
     gggggcgggg tgtggcacga cgacgcgtgc aacctcgcgt tcggcgcttc gtggtgctcg       420
     tgcggggcga acctcaccgg cgacggcccg ctgtggggca cggcgtga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page