(data stored in ACNUC7421 zone)

EMBL: CP001958.PE75

CP001958.PE75        Location/Qualifiers
FT   CDS_pept        51744..55466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0075"
FT                   /product="Phage-related protein"
FT                   /note="KEGG: ami:Amir_3249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96568"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P1"
FT                   /inference="protein motif:COG:COG5412"
FT                   /protein_id="ADG96568.1"
FT                   /translation="MATNLSDVYVTIIPETRRVGEAIRAAFRDAEREAKLSSERMGRDL
FT                   DRELGDVHVTVKVGADTKRARREVDELKTHGQRAGEAMGTATGLAFGKMFSAQLGLVKF
FT                   ASLGAAGGLALSGLGGSLASIVGVASRASGALALVPAAAMGAAASVSALKLGVSGLSDA
FT                   FKAMEDPQKFANALQKLSPAAQESAKAVYALKPAFDSMKNTVQDSLFAGLAPQITQLGR
FT                   TYLPVVQQGFAGVAGAANQAGKSVAAWAQTPEAVGQVNKLLGNTTAGMNILATAARPAV
FT                   QAVLGLGAAGSDSLPRLSQAVADVSNRFAGFVKNASESGRITEWIDAGLTSLTQLGHAI
FT                   GAVGSVFATVFKAGSAVGGGMLGTITQVADKFNDFLKSADGQAALSGFFTGISQAAAAL
FT                   APILGTLAQIVGTTIVPALSNLGTAVAPALNGMLQGLGAGLNAIKPVFEQLSGPLSQIG
FT                   QVIGDVLAKTLPILAPALVPLAQAFADLLSAIAPLIPPIAQLASMFVQAVAPALSVVFQ
FT                   ALAPVIQQLMDALKPVLDQLGPVLAQVAQTLAGLLVQAIQELLPPLMPLVKSFADFLAA
FT                   VLPLLPAVVKVAAVIAGALVKAMAATLPLAVSVVKAMVDFSTKIANFVVPWVSKLADGF
FT                   GWLGDKVKSLIGWFSGVKDAAGEASGSVSSFASATPAPFAFPQTSGGVPGGGEPSALAN
FT                   RLRRSAGTPEGMDRAEAGRLGQSLAASATPDANGSLLADASRLLADYATGKGDQDAVAR
FT                   AAELIDQASKGGAYVPDSDPPPPAVPLPPVPAPLPVPAAPVLPAPSAGKGGKAPALAPI
FT                   TMADLDKYDTPGLETGAPVTVAPGSPARAEQSVPATMGVDVYTGMGQTGGGSGAQQGID
FT                   FAHSMTGTAYSQQVFGRIGIDCSGMVSATVNAAEGKDPFSSRMSTVNEGEWLKAHGAVE
FT                   GMGGPGDLSIGWWNKGSSGGNNGHTALTLPNGENVESGGSHGVVAVGAGAAGAGDKQFD
FT                   HHMHIPKELLGSVPTAAGYAPALSGASGDWRSRTADRAVQNAQDSVKDHQWRVDQAKRR
FT                   MIEAKTQQQRDMAEHALIVAERELAKSHEKLRDAQDKRAETMAKARQKGQRGGSDGAED
FT                   FGHSLVSGALSGLGLDGSLLDNPLEWSGVKWLTSMVNGFTKPAQGQQGRYGSDGAALPG
FT                   FGPPASDPAQLASLGAQGLSQGFGADSGSQPSPAQVDQSINLTGQFGNPNDTARAMRAE
FT                   MDNRNRAFSMNAGRM"
     gtggcgacca atctctctga cgtctatgtg accatcatcc cggagacccg ccgcgtcggg        60
     gaagcgatcc gggcggcgtt tcgggacgcg gagcgcgagg ccaagctctc ctccgagcgc       120
     atgggccgcg acttggaccg cgaactcggg gacgtgcatg tcacggtgaa ggtcggcgcg       180
     gacacaaagc gcgccaggcg cgaggtggac gagctcaaga cgcacgggca gcgcgccggg       240
     gaggcgatgg gcaccgccac cgggctcgcg ttcgggaaaa tgttctcggc gcaactgggc       300
     ttggtgaagt tcgcgtccct cggcgcggca gggggcctcg ctttgtcggg cctcggcggc       360
     tccctcgcct ctatcgtcgg ggtcgcctcc cgcgcatcgg gggcgttggc gctggtgccc       420
     gccgccgcga tgggcgccgc ggcctcggtg tcggcgctca agctgggggt gtcggggctg       480
     tcggacgcgt tcaaggcgat ggaagacccg cagaagttcg cgaacgcctt gcagaagctc       540
     tccccggccg cgcaagagtc cgccaaggcc gtgtacgccc tcaaaccggc gttcgacagc       600
     atgaagaaca cggtgcagga ctcgctgttc gccggtctcg ccccgcaaat cacccaactc       660
     gggcggacgt atctgccagt ggtgcagcag gggttcgcgg gcgtggcggg ggcggcgaac       720
     caggcgggca agtccgtggc ggcgtgggcg cagacccctg aggcggtggg gcaggtcaac       780
     aagcttttgg gcaacaccac ggcgggcatg aacatcctcg cgaccgccgc gcgcccagcg       840
     gttcaggcgg tgctggggct cggggccgct ggctcggact ccctcccgcg cctctcccag       900
     gccgtcgcgg acgtgtcgaa caggttcgcg gggttcgtga aaaacgcctc ggagtcgggc       960
     cggatcaccg agtggatcga cgccgggctg acctcgctca cccaattggg gcacgccatc      1020
     ggcgcggtcg gctcggtgtt cgccaccgtg ttcaaagcgg gctcggctgt gggcggcggc      1080
     atgctcggga cgatcacgca ggttgccgac aagttcaacg acttcctcaa gagcgcggac      1140
     gggcaagcag ccctgtcggg gttcttcacc ggcatcagcc aagccgcagc ggcgctcgcc      1200
     ccgatcctcg gcacgctcgc gcagatcgtc ggcacgacca tcgtcccggc cctgtcgaat      1260
     ttgggcaccg ctgtggcgcc cgccctgaac ggcatgctgc aaggcctcgg ggcggggttg      1320
     aacgcgatca aaccggtgtt cgagcaactg tcggggccgc tctcgcagat cgggcaggtc      1380
     atcggggacg tgctggcgaa gaccctcccg atcctcgccc cggcgctggt gccgctcgcg      1440
     caggcgttcg cggacctgct ctccgctatc gcgccgctga tcccgccgat agcgcagctc      1500
     gcgtccatgt tcgtccaggc cgtcgcgccc gcgctctctg tagtcttcca agccctcgcc      1560
     ccggtcatac agcagctcat ggacgcgctc aagccggtcc tcgaccagct cggccccgtc      1620
     ctcgcgcagg tggcgcagac gctcgcggga cttttggtgc aggcgatcca ggagcttctg      1680
     ccgccgctga tgccgttggt gaagtcgttc gcggacttct tggcggcggt cctgccgctg      1740
     ctgcccgccg tggtgaaggt cgccgccgtc atcgcgggcg cgctggtcaa ggcgatggcc      1800
     gcgaccctgc cgctcgcggt ttcggtggtc aaggcgatgg tggacttctc cacgaagatc      1860
     gcgaacttcg tggtgccgtg ggtgagcaag ctcgcggacg gcttcgggtg gctcggggac      1920
     aaggtcaaat ccctcatcgg ctggttcagc ggcgtgaagg acgcggcggg cgaggcctcg      1980
     ggctcggtga gctcgttcgc gtccgccacg cccgcgcctt tcgcgttccc gcagacaagc      2040
     ggcggggttc cgggaggcgg ggagccttcc gcgctcgcga accgcctgcg ccgttcggcc      2100
     ggaacgccgg agggcatgga ccgcgcggag gcggggcggt tgggccagtc gctcgcggca      2160
     tcggccacac ccgacgccaa cgggtcgctg ctggccgacg cttcgcgcct gctggcggac      2220
     tacgcgacag ggaagggcga tcaggacgcg gtggcgcggg ctgcggaact catcgaccag      2280
     gcgtccaagg gcggggcgta tgtacccgac tcggacccgc cgcctcctgc cgtcccgctg      2340
     ccgcctgttc cggcgccgct gccggtccct gccgccccgg tcctgcctgc gccgtcagcg      2400
     ggcaagggcg gcaaagcgcc cgcgctggcg ccgatcacga tggcggattt ggacaagtac      2460
     gacacgccgg ggttggagac cggcgcccct gtgaccgtgg cgccgggttc cccggcccgc      2520
     gcggaacaga gcgtgcccgc gacgatgggc gtggacgtgt acaccggcat ggggcagacc      2580
     gggggcggct cgggcgctca gcagggaatc gacttcgcgc actccatgac cggcaccgcg      2640
     tactcgcagc aggtgttcgg gcggatcggc atcgactgct cggggatggt gtccgcgacg      2700
     gtgaacgccg cagaaggcaa agacccgttc tcctcgcgca tgtccaccgt caacgagggc      2760
     gaatggctca aggcgcacgg cgcggtggag gggatgggcg gtcctgggga tctgagcatc      2820
     ggatggtgga acaaaggctc ctctggcggc aacaacgggc acacggcgtt gacgctcccg      2880
     aacggggaga acgtggagtc cgggggcagc cacggcgtcg ttgccgtggg ggcgggcgcg      2940
     gccggtgcgg gcgacaagca gttcgaccat cacatgcaca tcccgaagga gctgttgggc      3000
     tccgtgccca ccgctgcggg ctacgcgccc gcgctctcgg gcgcttcggg ggattggcgc      3060
     tcgcgcaccg ccgaccgcgc ggtgcagaac gcgcaggact cggtgaaaga ccaccagtgg      3120
     cgcgtggacc aggccaagcg gcgcatgatc gaggcgaaga cgcagcagca gcgcgacatg      3180
     gcggagcacg ccctgatcgt cgcggagcgc gagctggcga agtcgcacga gaagctgcgg      3240
     gacgcgcagg acaagcgcgc ggagacgatg gcgaaggcgc ggcagaaggg gcagcggggc      3300
     ggttcggacg gcgcggagga cttcgggcac tccctggtct cgggggcgct ctccgggctc      3360
     ggtttggacg gctcgctctt ggacaacccg ttggagtggt ccggggtgaa gtggctcacg      3420
     tcgatggtga acggtttcac caagcccgcg cagggccagc agggccgcta cggctcggac      3480
     ggggccgctc tgcccggttt cgggcccccc gcgtccgacc ccgcccaact cgcctcgctc      3540
     ggcgcgcagg gcctctcgca aggcttcggc gccgattccg gctcgcagcc ctccccggcc      3600
     caggtggacc agtcgatcaa cctcacgggc cagttcggca acccgaacga cacggcgcgg      3660
     gcgatgcgcg cggagatgga caaccgcaac cgggcgttct ccatgaacgc ggggaggatg      3720
     tga                                                                    3723
//

If you have problems or comments...

PBIL Back to PBIL home page