(data stored in ACNUC7421 zone)

EMBL: CP001958.PE76

CP001958.PE76        Location/Qualifiers
FT   CDS_pept        55466..56728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0076"
FT                   /product="bacteriophage protein"
FT                   /note="KEGG: mab:MAB_1797 bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96569"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P2"
FT                   /inference="similar to AA sequence:KEGG:MAB_1797"
FT                   /protein_id="ADG96569.1"
FT                   /translation="MAYQRTDMTQYPSQHPDLRTPQGDYPPFGRPLTEYFQSWENVPPV
FT                   LRSDQLTVIYVGVPDERGVRAMWHLAGPRRGLEGVALATDLSGLVMPEFERAWHESAWM
FT                   TGAVPGHLSWPKRLLNLGVHISAPRLPRTILAADGRLERLVASSSADRYRLTHQLWWNS
FT                   FSMDADGDLLCFTRTTGFRNLKVRLAKAPAGTLETDPAAFGNNRITVDLPLVASDPFFA
FT                   SPASMGTWRNNEDTATPLDALEELVRKVIPDADFTFAKTALALVAEALGNLIPGIDVGQ
FT                   GHIAVRNDGDVPAWPEYVIHSGSGGFCWLPDGDRMVMLPRLLPTDGKVLVSTDPSKKTF
FT                   TAENEPVDIGFLGVVARSQLLDLVLKPFLEATEPLWRRGAEVFFTKPIPPKTTVQLPVR
FT                   HSNENAVITARVPQRHYGPGI"
     atggcctacc agcgcacgga catgacgcag tacccgagcc agcacccgga cctgcggacc        60
     ccgcaagggg actacccgcc gttcgggcgc ccgctcaccg agtacttcca aagctgggag       120
     aacgtcccgc ccgtgctgcg ctcggaccag ctcaccgtga tctacgtcgg tgtgcccgac       180
     gagcgcgggg tgcgggcgat gtggcatttg gcggggccgc gccggggctt ggagggcgtc       240
     gctttggcga cggacctctc cgggctggtc atgcccgagt tcgagcgcgc gtggcacgag       300
     tcggcgtgga tgaccggcgc cgtgccgggg catttgtcgt ggcccaagcg gctcttgaac       360
     ctcggcgtgc atatcagcgc gccgcgcctg ccgaggacga ttctggcggc ggacgggcgc       420
     ctggagcggc tggtggcgtc gagcagcgct gaccgctacc ggttgacgca ccagttgtgg       480
     tggaactcgt tctcgatgga cgcggacggc gaccttttgt gcttcacccg cacgacgggc       540
     ttccgcaatc tcaaggtccg tctcgcgaaa gcccctgccg ggacgttgga gacggacccc       600
     gccgcgttcg gcaacaaccg gatcaccgtg gatctgccct tggtcgcctc ggacccgttc       660
     ttcgcttcgc ccgcctcgat ggggacgtgg cgcaacaacg aggacaccgc cacgccgctg       720
     gacgcgttgg aagaattggt gcgaaaggtg atcccggacg cggacttcac gttcgcgaag       780
     accgcgctgg ctctggtcgc ggaggcgctg ggcaacctga taccgggcat cgacgtgggg       840
     caggggcata tcgcggttcg caacgacggc gacgtgccgg cgtggcccga atacgtgatc       900
     cactccgggt ccggggggtt ctgctggctc ccggacgggg accggatggt gatgctgccg       960
     aggctgttgc ccacggacgg gaaagtgctc gtgtccaccg acccctccaa gaagaccttc      1020
     accgctgaga acgagccggt ggacatcggg ttcttgggcg tggtggcccg ctcgcagttg      1080
     ttggacctgg tgctcaaacc gttcttggag gccacggagc cgttgtggcg gcgcggcgcg      1140
     gaagtgtttt tcaccaaacc gatccccccg aagaccaccg tgcaattgcc ggtgcggcac      1200
     tccaacgaga acgccgtcat caccgcccgc gtcccgcaac gccactacgg gccggggatc      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page