(data stored in ACNUC7421 zone)

EMBL: CP001958.PE79

CP001958.PE79        Location/Qualifiers
FT   CDS_pept        58751..59812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0079"
FT                   /product="bacteriophage minor tail subunit"
FT                   /note="KEGG: mab:MAB_1800 bacteriophage minor tail subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96572"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P5"
FT                   /inference="similar to AA sequence:KEGG:MAB_1800"
FT                   /protein_id="ADG96572.1"
FT                   /translation="MADVPQPGDKVYMFSADARMDFQGIVLDPDVPLNMAATMQMVGMN
FT                   GVVTFPVLVGRQGPPGVDRPIIKLIYDPQIDDASKLPQLTNTPEDVQKGYVIGSLCHWW
FT                   DGRQWRGIQLGVPGPSGPVPIISWSVVLLDPDGSEESNVKVTGSDAAPGVQLRLKVPKG
FT                   PKGDSGSIRLASDYDDATPPAVGDLLTWTPEKKWAPRSLGKEDVAYYTVPQSQFKAQSL
FT                   VVGANVPVGSFTIPKQSFDWKPWVSGCVKITGAELDLDPFSSRIEVRKDSMDGPLCAVG
FT                   FGTPTTMTVVSPHFSSPGNKTAAVNANNDAMRCEAGKDAVFHVVIAMDQGIGGVYSYNP
FT                   DWTEFHVECKRVN"
     atggccgatg tgccgcagcc gggggacaag gtgtatatgt tctcggcgga cgcgaggatg        60
     gacttccagg ggatcgtgct cgacccggac gtgccgttga acatggccgc gaccatgcag       120
     atggtcggca tgaacggggt ggtgaccttc ccggtgctgg tggggcggca aggcccgccc       180
     ggggtggacc gcccgatcat caaattgatc tacgacccgc agatagacga cgcctcgaag       240
     ctgccgcagc tgacgaacac ccccgaggac gtgcagaagg ggtatgtcat cggttcgctc       300
     tgccactggt gggacgggcg gcagtggcgg ggaatccaac tgggcgtgcc ggggccaagt       360
     ggcccggtgc cgatcatctc gtggtcggtg gtcttgttgg acccggacgg ctccgaggag       420
     tcgaacgtga aggtcacggg ctcggacgcg gctccggggg tccagttgcg cctcaaggtg       480
     cccaagggtc cgaaaggcga ttcggggagc atccgccttg cgagcgacta cgacgacgcg       540
     acgccgcccg ctgtcgggga cctgctcacg tggaccccgg agaagaaatg ggcgccgcga       600
     tctttgggca aggaggacgt ggcctattac acggtgccgc agagccagtt caaggcgcaa       660
     tcgctggtgg tgggcgcgaa cgtcccggtc gggtcgttca cgatccccaa gcagtccttc       720
     gactggaagc cgtgggtgtc ggggtgcgtg aagatcaccg gggcggaact ggacttggac       780
     ccgttctcct cgcgcatcga ggtccgcaag gactcgatgg acggcccgtt gtgcgcggtg       840
     gggttcggga cgcccacgac gatgaccgtg gtgtcgccgc atttctcctc gccgggcaac       900
     aagacggcgg cggtgaacgc gaacaacgac gcgatgcgct gcgaggcggg caaagacgcg       960
     gtgttccacg tcgtgatcgc gatggatcag ggcatcggcg gggtgtactc gtacaacccg      1020
     gactggacgg agttccatgt cgagtgcaag cgggtgaact ag                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page