(data stored in ACNUC7421 zone)

EMBL: CP001958.PE82

CP001958.PE82        Location/Qualifiers
FT   CDS_pept        62400..62756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SORBIDRAFT_07g002060; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96575"
FT                   /db_xref="GOA:D6Z9P8"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96575.1"
FT                   /translation="MNVISLPYKWRVALYQVLKLASAAVGALFVIAPLFGWELPNTKLD
FT                   ALDQLVFAVVSLLGLGAGSVATEHAKISTDGPLPDPRAQAPQPDPMAVAAQTVAMTIEG
FT                   VLAQLERLAKPQGE"
     gtgaacgtga tatccctccc ctacaagtgg cgcgtcgccc tctaccaggt gctcaaactc        60
     gcgagcgccg ctgtcggcgc gttgttcgtg atcgcgccct tgttcgggtg ggagctgccg       120
     aacacgaaac tcgacgccct cgaccaactg gtattcgccg tcgtcagcct cttggggctc       180
     ggggcgggtt cggtcgctac agagcacgcg aagatctcca cggacgggcc gctcccggac       240
     ccccgcgccc aggcgccgca accggaccct atggcggtcg ccgcgcaaac cgtcgcaatg       300
     accattgagg gcgtgctggc acagttggag cgcttggcga agccgcaggg cgagtga          357
//

If you have problems or comments...

PBIL Back to PBIL home page