(data stored in ACNUC7421 zone)

EMBL: CP001958.PE83

CP001958.PE83        Location/Qualifiers
FT   CDS_pept        63031..63237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0084"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abn:AB57_1256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96576"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96576.1"
FT                   /translation="MRWPWQLRESVEFDGEDLDRRVREAQHAKDRADKLREEAAPLVAL
FT                   ARRQRRENGFGAAVERTMRRRHA"
     atgcgttggc cgtggcagtt gcgcgagtcc gtggagttcg acggcgagga tttggaccgc        60
     agggtgcgtg aggcgcagca cgcgaaagac cgcgcggaca agctgcgcga ggaggccgcg       120
     ccgctggtcg cgctcgcgcg ccgccaacgg cgggagaacg gtttcggcgc ggccgtggaa       180
     cggacgatga ggagacggca tgcgtag                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page