(data stored in ACNUC7421 zone)

EMBL: CP001958.PE85

CP001958.PE85        Location/Qualifiers
FT   CDS_pept        complement(63716..64015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_2756 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96578"
FT                   /db_xref="GOA:D6Z9Q1"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96578.1"
FT                   /translation="MNDKTKTEKTPPADSPISFFWCLLASGTLILLGFTLESKFGFILL
FT                   VSLGVGVYLFRVDERWRNAGRGVIAASLAGMVFYFGWPVFYISIPAAFLSILHH"
     ttgaacgaca agacaaaaac cgagaagaca ccaccagcgg acagccccat tagctttttc        60
     tggtgcctgc tcgccagcgg gacactcata ctcctggggt tcaccctgga atcaaaattc       120
     gggttcatcc tccttgtctc gctcggagtc ggcgtctatc tgttcagggt cgatgagcga       180
     tggcggaacg ccggaagagg tgtcatagcg gcttcgctgg ccggtatggt cttctacttc       240
     ggctggccgg tcttctacat cagcatcccc gcagcgttct tatcaatcct ccaccactga       300
//

If you have problems or comments...

PBIL Back to PBIL home page