(data stored in ACNUC7421 zone)

EMBL: CP001958.PE87

CP001958.PE87        Location/Qualifiers
FT   CDS_pept        complement(64298..64633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_4137 amino acid/peptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96580"
FT                   /db_xref="GOA:D6Z9Q3"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96580.1"
FT                   /translation="MNQRDRESDDTAPAQRLHGPESFAALVLTSAALMAVAALHMAWYV
FT                   PTVLILFLSGLAMSLTTGKQRKIGMGMLAATVSALLLRYVFWLFLYTIPGMFLALFSTK
FT                   DATHIQW"
     atgaaccagc gagaccgcga gagcgacgac acagcacctg cccagcggct tcacggcccg        60
     gaaagtttcg cggccctggt cttgacgtcc gcagcgctta tggcggtcgc cgccctgcat       120
     atggcttggt acgtgccaac agtgctgatt ctgtttttgt cgggactcgc tatgtcgctc       180
     acaaccggta agcaaagaaa aatcggtatg ggcatgttgg ccgcgacagt ctccgctttg       240
     ctgctcagat atgttttttg gctgtttctc tacacgatcc ccggaatgtt cctcgccctc       300
     ttctccacca aagacgcgac acatattcag tggtga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page