(data stored in ACNUC7421 zone)

EMBL: CP001958.PE88

CP001958.PE88        Location/Qualifiers
FT   CDS_pept        complement(64630..64902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0089"
FT                   /product="protein of unknown function DUF81"
FT                   /note="KEGG: vap:Vapar_3543 protein of unknown function
FT                   DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96581"
FT                   /db_xref="GOA:D6Z9Q4"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_3543"
FT                   /protein_id="ADG96581.1"
FT                   /translation="MPSIKLPAVSWAAATWSAPVAVCACLTAITFLVNLQPPGSKSLTF
FT                   PLLCGIVSTLSLLLWVFVRTPTARGVALGIFGVPFVLAWFVWLTQ"
     atgccatcca taaaactccc cgctgtgtcg tgggcggctg cgacgtggag cgcgcccgtg        60
     gcagtatgcg cttgcttgac ggcgataacc ttcctggtca atttgcagcc gccagggagc       120
     aagtccctaa cattcccgct cttgtgcggc atcgtctcaa cgctgtccct gttgttgtgg       180
     gtcttcgttc ggacccctac cgcgcgcggg gtggcgttgg gcatattcgg ggtgcccttc       240
     gtgttggcct ggttcgtgtg gttgacgcaa tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page