(data stored in ACNUC7421 zone)

EMBL: CP001958.PE91

CP001958.PE91        Location/Qualifiers
FT   CDS_pept        68434..69720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0092"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ach:Achl_0532 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96584"
FT                   /db_xref="GOA:D6Z9Q7"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG96584.1"
FT                   /translation="MTSLARSIAPLKGRDYRLLFLSCVISMLGDGVWLVAVPWLAIQNG
FT                   ADSAGVGAVVGAESVGLICFVLIGGVLTDRFSRKLVVGWSHCASFIVLAALGAITVTGS
FT                   MRLWHLALSAFLLGAAAAISGPATDALVPDIVPSDDLHAANALESMARSVALRIAGPTL
FT                   GGLLVALLPSVSVIAVNAASFFAAACCVALLRTARANPAASAETEAGGETKVSGRQFWR
FT                   YLYGERWLWVLILWAGVLLLLQTGPRQVLLPLLVHDRFDKGASSYGILIAASGVTAILA
FT                   SLYIGSRALPPNYPRRMLLAWMAGAVPLAAMVFVPSFWWLLPLMGVYGFFSTIGNVYWF
FT                   TLLQIHVPDEVRGRVISVDWLGSLALVPASAVLAGASQSPTYATSLFVLGGTLPVLFTA
FT                   VLLARVRMPEAKSAETATTKMFEDGVVVS"
     atgacctcgc tcgccagatc gatcgcgccg ctcaaggggc gcgactaccg actgctcttc        60
     ctctcttgcg tcatcagcat gctcggtgac ggagtatggc tggtcgcggt tccttggctg       120
     gcgatccaga acggcgccga ctcagcaggg gttggcgccg tggtcggagc cgagtccgtg       180
     gggctcatat gtttcgtgct catcggcggc gtgctcactg atcgtttttc cagaaagctt       240
     gtggtcgggt ggtcgcattg cgcgagcttc atcgtcctcg ccgccttggg cgccatcacc       300
     gtcaccggaa gcatgcgact atggcatcta gcgttgtcgg cgtttctgct cggagccgcc       360
     gcagcgatca gcggacccgc aactgacgct ctcgtgcccg acatcgttcc gtcagacgac       420
     ctccatgcgg cgaacgcgct ggagtcgatg gcacgctcgg tggccttacg gatcgctggg       480
     ccgacgctcg gaggactcct tgtcgcgctc ctcccgtccg tctcggtcat cgccgtgaac       540
     gcggcgagct ttttcgcggc tgcctgctgt gtggcgctgt tgcgcaccgc gcgcgcgaac       600
     cccgctgcat ccgcagaaac ggaagcaggc ggggagacga aagtctctgg tcggcagttc       660
     tggcgctacc tctacggcga gcgctggctc tgggtgctca tcctctgggc cggggtgctg       720
     ctactcctgc aaacagggcc gagacaagtg ctcctccccc tccttgtcca tgaccgcttc       780
     gacaagggag ccagctcgta cggcatcctc atcgcggcat ccggagtcac cgcgatcctg       840
     gcctcgctct acatcgggtc acgtgcgctg ccgccgaact atccacgacg catgctgctc       900
     gcatggatgg ccggggctgt gccgctggcc gcgatggtct tcgtcccttc gttctggtgg       960
     ctgctgccgc tgatgggcgt gtatggcttc ttctccacca tcggcaacgt gtactggttc      1020
     acgctcctcc aaatccatgt gcccgacgaa gtgcgtggac gagtgattag cgtcgattgg      1080
     ttggggtctc tcgcgctcgt gcccgcctcg gcggtgctcg cgggtgcgag ccaaagccct      1140
     acctacgcca catcattatt cgtgctcggc gggacgctgc cagttctctt cacagcagtg      1200
     cttcttgccc gagtgcgcat gcccgaggcc aagagtgctg agacggcaac taccaaaatg      1260
     ttcgaagacg gtgtggtcgt gagttga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page