(data stored in ACNUC7421 zone)

EMBL: CP001958.PE93

CP001958.PE93        Location/Qualifiers
FT   CDS_pept        71199..72395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0094"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   msl:Msil_0516 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96586"
FT                   /db_xref="GOA:D6Z9Q9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG96586.1"
FT                   /translation="MTAVASARTVRGLDGLVFFLADVQSGLGPFLAVYLASRGWDEQRV
FT                   GIALTVGGLAAIVFQAPAGALVDRLRAKRALTAAAVAALACAALAVAFVPRFWPVLGAQ
FT                   AVIGAAGTVFGPMMCALALGVVGPAGFDRRQGRNQSLNSAGNVFAAVSMGLLGYYVSNR
FT                   SVFFFAAACAVPVFLSLRAIRAEEIDHAAARGSAPSASGSGGSRGMFSDWRLGVFLVCA
FT                   VMFHFANAAMLPLLGERLAKGQGASSMMFMSACVITTQLVIACIAAPVGALAGSWGRKP
FT                   LLLVAFAVLPVRGVLYTLTDSTVSLVAIQVLDGIGAGVFGVVSVLVIADLTKGTGRFNL
FT                   VLGLMSTAVAVGASLSQTVAGSIAHHGGFDAAMLSLAGIAAAAFLLLAVRMPETRTSG"
     atgacggctg ttgcgtctgc gcgcacggtg cgggggttgg acgggctggt gttcttcctc        60
     gcggatgtgc aaagcgggtt gggccctttc ctcgcggtgt atctggcttc gcggggttgg       120
     gacgagcagc gggtcgggat cgcgctgacg gtcgggggtc ttgcggcgat cgtgttccag       180
     gccccggcgg gggcgctggt ggaccggctt cgcgcgaagc gggcgttgac ggcggcggcg       240
     gtcgcggcct tggcctgcgc ggcgctcgcg gtggctttcg tgcccaggtt ttggccggtg       300
     ctgggggcgc aggcggtgat cggcgccgct ggcacggtgt tcggcccgat gatgtgcgcg       360
     ctggcgctgg gggtggtcgg ccccgccggg ttcgaccgtc ggcagggccg caatcagtcg       420
     ctgaactccg ctggcaatgt gttcgcggcg gtgtccatgg gtttgctggg gtattacgtc       480
     tcgaatcgca gcgttttctt tttcgcggcg gcgtgcgcgg tgccggtgtt tttgtcgttg       540
     cgcgccatcc gcgcggagga gatcgaccat gcggcggcgc gtggttccgc gccgtcggcc       600
     agcggttccg gcgggagccg gggcatgttc tccgactggc ggctcggcgt gttcttagtg       660
     tgcgcggtga tgttccattt cgcgaacgcg gcgatgctgc cgctgctcgg cgagcgtctc       720
     gcgaaaggcc agggggcgag ttccatgatg ttcatgtccg cctgcgtcat caccacgcag       780
     ctggtgatcg cttgcattgc cgcgccggtc ggggcgctcg cgggctcatg ggggcgcaaa       840
     ccgttgctgc tcgtcgcctt cgctgtgctt ccggtccggg gggtgttgta caccttgacg       900
     gacagcacgg tctcgcttgt cgcgatccag gtcctcgacg ggatcggcgc aggtgtgttc       960
     ggcgtggttt ctgtgctggt catcgccgac ctgaccaagg gcacggggcg gttcaacttg      1020
     gtccttggcc tgatgagcac ggcggtcgcg gtgggggcgt cgctgagcca gaccgtcgcg      1080
     ggctccatcg cccaccacgg tgggttcgac gcggcgatgc tttccctcgc ggggatcgcc      1140
     gccgccgcgt tcctgctttt ggccgtgcgg atgccggaaa cccgcaccag cggctga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page