(data stored in ACNUC1104 zone)

EMBL: CP001966.PE100

CP001966.PE100       Location/Qualifiers
FT   CDS_pept        complement(106398..107978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0100"
FT                   /product="anibiotic ABC transporter efflux pump"
FT                   /note="KEGG: rha:RHA1_ro02954 anibiotic ABC transporter
FT                   efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76754"
FT                   /db_xref="GOA:D5UPY6"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY6"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro02954"
FT                   /protein_id="ADG76754.1"
FT                   /translation="MTGLGATLRLVVRRDRVQLVVWLLLYVAMAASAYSTAKVNYGDQA
FT                   ALESAARAASENPSLVAMFGPVYSATVGAVGMIKMVVMMAAALGLLTGLLVIRHTRADE
FT                   ESGRREMLGASAIDRIAPPLAALIESVGLSLAIGAVSALVLIGMGADAPGSVAFGALWA
FT                   LTGIVFAGFALLCAQLTEGARAARGLFAVGLGGAYLLRAVGDVSVLRIDGTLPAEPGWE
FT                   SWLSPLGWSQQIRPFADDRWWPALPLVVLTVVFAAAALRIAARRDLGAGLIPVGRGRSH
FT                   AGPLLGSVEALTWRLHRGQVIGWTVGMLAVGAAFGGMGSAIDSLAGNEGTREMLERLGG
FT                   SGSNLLDIFFGAEFSVMGMATAALGISIVNTACSEELSGRAEYLLSAPVLRLRWYVSHL
FT                   TVAVIATFVATLALGIGVSLTAGRELIGPALGALPAVWVITAIAALAGAIHAQWSAVGW
FT                   VALALCVVMMVADVLRLPDWVSTLSPFTHVATQPGAALVTGATVTLVAISAVGLIAAAT
FT                   AESRRDLAA"
     atgacggggc tcggtgccac tctgcggctg gtggtccggc gtgaccgggt tcaactggtg        60
     gtgtggctgc tgctgtacgt ggcgatggcc gcatcggcct actccaccgc caaggtcaat       120
     tacggcgatc aggccgcgct cgagtccgcg gcccgcgcgg cgagcgagaa cccctctctg       180
     gtcgcgatgt tcggccccgt ctattcggcc accgtcggtg ctgtcggcat gatcaagatg       240
     gtcgtgatga tggcggccgc tctgggcctg ctcaccggcc tgctggtgat ccggcacacc       300
     cgcgccgacg aggagtccgg tcgccgggag atgttgggcg cctccgcgat cgatcggatc       360
     gcgccgccac tggccgcact gatcgagtcg gtcgggctga gtctggccat cggcgcggtg       420
     agcgcgctcg tcctgatcgg gatgggcgcc gacgcaccgg gcagtgtcgc cttcggggca       480
     ctgtgggcgc tgaccggcat cgtcttcgcc gggttcgcgc tgctgtgcgc acaactgacc       540
     gaaggcgccc gggccgcgcg cgggttgttc gccgtcggcc tcggtggtgc gtacctgctg       600
     cgcgccgtgg gcgatgtgtc tgtgctccgt atcgatggca cgctgcccgc ggaacccggc       660
     tgggagtcct ggctttcgcc gctcggctgg tcacagcaga tccggccctt cgccgacgac       720
     cggtggtggc ccgcactccc cctggtggta ctcaccgtgg tgttcgccgc cgcggcgctg       780
     cggatcgccg cgcgccgcga cctcggcgcc ggactgatcc ccgtgggccg cggccggagc       840
     cacgccggac cgctgctcgg ttccgtggag gcgctcacct ggcggctgca ccgcggccag       900
     gtgatcggat ggaccgtggg catgctcgcc gtgggcgcgg cgttcggcgg gatgggctcg       960
     gcgatcgact cgctcgccgg gaacgagggc acccgggaga tgctggaacg actggggggt      1020
     tccggctcga acctgctcga catcttcttc ggcgcggagt tctcggtgat gggcatggcg      1080
     accgccgcgc tcggcatctc gatcgtcaac accgcctgtt ccgaggagct ctcgggccgc      1140
     gccgaatacc tcctatcggc acccgtgctg cggctgcgct ggtacgtctc acacctgacg      1200
     gtggcagtga tcgcgacctt cgtcgcgacc ctcgccctgg gcatcggagt ctcactcacg      1260
     gccggccgcg agctgatcgg accggccctc ggcgccctgc ctgcggtctg ggtgatcacc      1320
     gcgatcgccg ccctggcggg tgcgattcac gcccaatggt cggcggtcgg atgggtggcc      1380
     ctggcgctgt gcgtggtgat gatggtggcc gacgtgttac ggctgcccga ctgggtgtcg      1440
     acgttgtcgc cgttcaccca cgtggccact cagcccggtg ccgcgctggt gaccggggcg      1500
     accgtgacat tggtggcgat ctccgcggtg ggcctgatcg ccgccgccac cgccgaatcc      1560
     cggcgcgatc tggccgccta g                                                1581
//

If you have problems or comments...

PBIL Back to PBIL home page