(data stored in ACNUC1104 zone)

EMBL: CP001966.PE101

CP001966.PE101       Location/Qualifiers
FT   CDS_pept        complement(107975..108874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0101"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: nfa:nfa24770 putative ABC transporter ATP-
FT                   binding protein; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76755"
FT                   /db_xref="GOA:D5UPY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG76755.1"
FT                   /translation="MTNEVIRAEGLTKVFGSAHALTALDLHVLPGQVHAFLGPNGAGKS
FT                   TTIRILLGLLKKTSGTVELLGGDPWRQAPELHRRLAYVPGDVTLWPNLSGGEIIDLLGR
FT                   LRGGIDEVRRDELLERFALDPGKKARTYSKGNRQKVALVSAFAARAELLILDEPTSGLD
FT                   PLMEEVFTQCLEEEKARGASILLSSHILSEVDRVADAVTIIKDGATVETGTLASLRHLS
FT                   RTRVEATVSRPTDLSATAGVHDLRTDGDRLSFSVDTADLGRVLGELAAASPTSLTSRPP
FT                   TLEELFLRHYDTAERGTR"
     atgaccaacg aagtcatccg cgccgagggc ctgaccaagg ttttcggtag cgctcacgct        60
     ctcaccgcgc tcgatctgca cgtcctgcca ggacaagtgc acgccttcct cgggccgaac       120
     ggcgcgggta agtcgaccac catccgaatc ctgctgggcc tgctgaagaa gaccagcggc       180
     accgtcgaac tactcggcgg agacccgtgg cgccaggccc ccgaactgca ccggcggctg       240
     gcctacgtac cgggcgatgt gacgctgtgg cccaacctgt ccggtggcga gatcatcgac       300
     ctcctcggtc gcctgcgcgg cggcatcgac gaggtgcgcc gcgacgaact cctggagcgc       360
     ttcgccctcg atcccggaaa gaaggcccgc acgtacagca agggcaaccg gcagaaggtg       420
     gcactggtct cggccttcgc ggcccgcgcc gaactgctca tcctcgatga gcccacctcc       480
     ggcctggacc cgctcatgga ggaggtgttc acgcagtgcc tcgaggagga gaaggcccgc       540
     ggcgcctcga tcctgctctc cagccacatc ctgtccgagg tcgaccgggt cgccgacgcc       600
     gtcacgatca tcaaggacgg cgcgaccgtc gagaccggca ccctggcctc gctgcggcac       660
     ctgtcccgca cccgggtcga ggccaccgtg tcgcgaccca cggacctgtc cgcgaccgcg       720
     ggcgtacacg acctgcgaac cgacggcgat cgcctctcgt tcagcgtgga caccgcagac       780
     ctcggccggg tgctcggcga actcgccgcc gcctccccca cctcgctcac cagccgcccg       840
     cccacactcg aagagctctt cctgcggcac tacgacaccg ccgaacgggg cacgcgatga       900
//

If you have problems or comments...

PBIL Back to PBIL home page