(data stored in ACNUC1104 zone)

EMBL: CP001966.PE102

CP001966.PE102       Location/Qualifiers
FT   CDS_pept        108915..109400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76756"
FT                   /db_xref="GOA:D5UPY8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY8"
FT                   /inference="similar to AA sequence:KEGG:SCO3632"
FT                   /protein_id="ADG76756.1"
FT                   /translation="MKTVYPVCVDAPNFVENMAAALVEAGMQRMAARVFSAVLASPDGA
FT                   LTPSQIAKQLRVSAGAVSGAVGYLEQAGMIRKSHVPGSRHSLIELGDDIWYEALTSRNP
FT                   ILERWLTVADEGLEELPDGGPAAERVAVMRDFFAFVLTELPDLMERWRLTRLERHGH"
     gtgaagactg tatatcctgt gtgcgtggac gcgccgaact tcgtcgagaa catggctgcc        60
     gccctggtgg aggcgggtat gcagagaatg gccgcccgcg tcttctcggc cgtgttggcc       120
     tcgcccgatg gcgcgctcac accgtcgcag atcgcgaaac agctcagggt ctcggccggg       180
     gcggtctcgg gcgcggtcgg ttacctcgaa caggccggca tgatccgcaa gtcccatgtt       240
     cccggttcgc ggcacagcct gatcgagctg ggtgatgaca tctggtacga ggcgctcacc       300
     tcgcgtaatc cgatcctgga gcggtggctc acggtggccg acgaggggct cgaagagctc       360
     cccgacggtg ggccggcggc cgagcgggtg gcggtgatgc gcgacttctt cgcattcgtc       420
     cttaccgagc tgcccgatct gatggagcgc tggcggctga ccaggctcga acggcacggg       480
     cactga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page