(data stored in ACNUC1104 zone)

EMBL: CP001966.PE103

CP001966.PE103       Location/Qualifiers
FT   CDS_pept        109597..110211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76757"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76757.1"
FT                   /translation="MNTQVTKSVAALVGVAATIALGFSGAATASASPKPYPSGGANSVD
FT                   LVEVTAQASAIGKDNGFTIRNVADRADPNAGQAQRAQVLPAGTQFVLSSNNFGNVALGD
FT                   TEGYSVTLLTANGRDKVITLKNDIQPGGSIPVTLGKIQVSVGTTFNLKLADYSVQPFRT
FT                   KGALDWTERANPNQTQYLANNSAGVFCLAAVAPVLSFCSPA"
     gtgaacactc aggttacgaa gtccgtcgcg gccctcgtcg gggtcgccgc cacgatcgcc        60
     ctcggattct ccggtgccgc aacggcatcc gcatccccca agccgtatcc gtccggcggt       120
     gccaacagcg ttgatctcgt ggaggtgacc gcgcaggcgt cggcgatcgg caaggacaac       180
     ggtttcacca tccgcaacgt cgccgatcgg gccgatccga acgcgggcca ggcgcagcgc       240
     gcgcaggtcc tgccggcagg tacccagttc gtgttgagct ccaacaactt cggcaacgtc       300
     gctctgggcg acaccgaggg ctattcggtc accctgctca ccgccaacgg ccgggacaag       360
     gtgatcacgc tgaagaacga tatccagccg ggtggctcga tcccggtgac gctcgggaag       420
     atccaggttt cggtgggcac caccttcaat ctgaagctgg cggactactc ggtccagccc       480
     ttccgcacga agggtgctct ggactggacg gagcgcgcga acccgaacca gacgcagtac       540
     ctcgcgaaca attccgccgg ggtgttctgc ctcgcggcgg tggcgcccgt gctcagcttc       600
     tgctcgccgg cgtaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page