(data stored in ACNUC1104 zone)

EMBL: CP001966.PE104

CP001966.PE104       Location/Qualifiers
FT   CDS_pept        complement(110276..110866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0104"
FT                   /product="peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; KEGG: bcv:Bcav_2708 peptidase M15B and M15C
FT                   dd- carboxypeptidase VanY/endolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76758"
FT                   /db_xref="GOA:D5UPZ0"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ0"
FT                   /inference="protein motif:PFAM:PF02557"
FT                   /protein_id="ADG76758.1"
FT                   /translation="MSNHRKARTAAAAIAALAALALLSACSPSLPGSAAPGDPTPSGRP
FT                   TAAPSGPIGAADGALTEGVPVTTDTPAITNLSPALRQALQGAARAAKAERDIDVLVTSG
FT                   WRTARYQQSLFDDAVRRYGSTAEAERVVAGTTSEHVAGDAVDIGPTDAADWMTRFGEDY
FT                   GLCRVYANEMWHFEAKSGAQCAPMVSDASRRSR"
     atgtcgaacc accgcaaggc tcgcaccgcc gcggctgcca tcgccgcact ggccgcgctc        60
     gcactcctgt cagcctgctc gccgtcgctg cccggctctg cggctcccgg cgaccccacc       120
     ccgtcaggcc gtccgacggc cgcaccgtcc ggtccgatcg gcgcggccga cggcgccctc       180
     accgagggtg tcccggtcac caccgacacg cccgccatca ccaatctgtc tcccgcactg       240
     cggcaggccc tgcagggcgc tgcccgcgcc gcgaaggcgg agcgcgacat cgacgtactc       300
     gtgacctcgg ggtggcgcac tgcccggtac cagcagtcgc tgttcgacga tgcggtccgg       360
     cgatacgggt cgaccgccga agcggaacgt gtggtggccg gcaccacgtc cgagcacgtc       420
     gccggagacg ccgtcgacat cggtccgacc gacgccgccg attggatgac ccggttcggt       480
     gaggactacg ggctgtgccg ggtgtacgcc aacgagatgt ggcacttcga agcgaagagc       540
     ggcgcgcaat gcgcgccgat ggtctccgac gcctcgcgcc gttcacgctg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page