(data stored in ACNUC1104 zone)

EMBL: CP001966.PE109

CP001966.PE109       Location/Qualifiers
FT   CDS_pept        complement(119269..119781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0109"
FT                   /product="Protein of unknown function DUF2302"
FT                   /note="PFAM: Protein of unknown function DUF2302; KEGG:
FT                   rer:RER_47870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76763"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ5"
FT                   /inference="protein motif:PFAM:PF10064"
FT                   /protein_id="ADG76763.1"
FT                   /translation="MSDLDDLLKSIPLADIAAQLGVSQDVASAAVNQTVPTLLAGLQAQ
FT                   DTTEAPSDLAQAADNGDGQQIVSSLFGEKTDDVAAAAAAPLSSGVTNDLVKQLLPILAP
FT                   IVISFVMKKLSGGTAAQPQQQAPAGNGDLLGSILGNMLGGGNTAGGAGSAAGNVLGGIL
FT                   GGLLNRK"
     gtgtccgatc ttgacgatct gctcaagtcc atcccgctcg ccgatatcgc cgcgcagctc        60
     ggcgtctcgc aggacgtcgc ctccgcggcc gtcaaccaga ccgttccgac cctgctcgca       120
     ggcctccagg cccaggacac caccgaggcc ccgtccgatc tcgcccaggc cgcggacaac       180
     ggcgacggcc agcagatcgt ttccagcctg ttcggcgaga agaccgacga cgtggccgcc       240
     gcggccgccg caccgctgtc ctcgggcgtc accaacgacc tggtcaagca actgctcccg       300
     atcctcgcac cgatcgtgat cagcttcgtg atgaagaagc tctcgggcgg taccgctgcg       360
     cagccgcagc agcaggcgcc ggcaggcaat ggcgacctgc tcggcagcat cctcggcaac       420
     atgctcggcg ggggcaacac cgcgggcggc gccggcagcg cggccggcaa cgtgctcggc       480
     ggcatcctcg gcggtctgct caaccgcaag tag                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page