(data stored in ACNUC1104 zone)

EMBL: CP001966.PE11

CP001966.PE11        Location/Qualifiers
FT   CDS_pept        14819..15517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_34980 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76665"
FT                   /db_xref="GOA:D5UPB3"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB3"
FT                   /inference="similar to AA sequence:KEGG:ROP_34980"
FT                   /protein_id="ADG76665.1"
FT                   /translation="MSTPGTGPGQPSEPGPEQAGRQPVRIPRRDTDLGRVIDAPTEGVE
FT                   RDELPKDLPDLDKIHHVTPADAPTTPVATTPPPAATAPAEPEPEAAPSNLHTVGSTPAR
FT                   AAGVKTQAATGPVRAAMQLRSIDPWTTFKLAGVVSVVLFFVWMIAVGALYVILNGMGVW
FT                   SKINDSFQTLVNEQAGSSILTAGDVFLYSGLVGLANVVLLTALATVGAFIYNLCADLVG
FT                   GVEVTLADRD"
     gtgagtaccc ctggaaccgg ccccgggcag cccagcgagc ccgggccgga gcaggcgggt        60
     cgacagcccg tccggatccc gcgacgggac accgacctcg gccgcgtcat cgacgcaccc       120
     accgagggcg tggagcggga cgagctgccg aaggatctgc ccgatctcga caagatccac       180
     catgtgaccc cggcggacgc gcccaccact ccggtggcca cgacgccgcc tccggcggcc       240
     accgcgccgg cggagcccga gcccgaggcc gcaccgtcga acctgcacac cgtgggcagc       300
     acgccggccc gcgccgcggg tgtgaagacg caggccgcaa cgggacccgt gcgggccgcg       360
     atgcaactgc ggtccatcga tccgtggacc acgttcaagc tcgcgggtgt ggtctcggtg       420
     gtgctcttct tcgtgtggat gatcgccgtg ggcgcgctgt acgtgatcct caacggcatg       480
     ggcgtgtggt cgaagatcaa cgacagtttc cagaccctgg tcaacgagca ggccggatcg       540
     tcgatcctca cggccggcga cgtgttcctg tactccgggc tggtgggttt ggcgaacgtg       600
     gttctgctga ccgccctcgc caccgtcggg gcgttcatct acaacctgtg cgccgacctc       660
     gtgggcggcg tcgaggtgac cctcgccgat agggattga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page