(data stored in ACNUC1104 zone)

EMBL: CP001966.PE110

CP001966.PE110       Location/Qualifiers
FT   CDS_pept        complement(120144..121070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0110"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   rha:RHA1_ro03731 alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76764"
FT                   /db_xref="GOA:D5UPZ6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ6"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG76764.1"
FT                   /translation="MTTTPATTAQCTNRMVVLPAHWTTKSTTLGSVLLELANVRTHVVI
FT                   DQPTGPVTGPPVVLSSGLAGNWFDWDSCIELLRSERTVIRFDRPGYGLSDPWPEDTVPT
FT                   LDGEVRRYRDLLDALQIQRGVICGHSMASFYVEAFAREHPERTAAAVILDGSVEDSPRW
FT                   VLPTNLRADLLLRSADVAAASGLSRIGPAVHKLLVDSEPPAEHAQILSSEQYLRAAMLE
FT                   NGQYPVLAHELVDLRTKQPLQPGLPVTVAAAYTGRPTPWAASWLRQQRGLADRLDARFA
FT                   VIAPSGHHVMVEQPAQVAALILDAGGG"
     gtgaccacca cccccgcaac caccgcacaa tgtacgaacc gcatggtcgt cctccccgct        60
     cactggacta cgaagagtac tactctcggc tccgtgttgt tggagctcgc aaatgtgcgc       120
     acccacgtgg tgatcgacca accgaccggc ccggtcaccg ggcctcctgt cgtgctgtcg       180
     tcgggcctcg cgggcaactg gttcgattgg gattcgtgca tcgaactgtt gcgctccgag       240
     cgcaccgtga tccgcttcga ccggccgggg tacgggctct ccgacccttg gccggaggac       300
     accgtcccca ccctcgacgg cgaagtacgc cgctatcgag acctactgga cgccttacag       360
     atccagcgtg gggtgatctg cggccattcg atggcgagct tctacgtgga agcgttcgcg       420
     cgcgaacacc ccgagcgcac cgcagcggcg gtgatcctgg acggcagcgt ggaggactca       480
     ccccgctggg tgctcccgac aaacctgcgc gccgacctgt tgctccgttc ggcggatgtg       540
     gcagcggcgt cgggcctgag ccggatcggc cccgcggtcc acaagctcct cgtcgattcc       600
     gaaccgcccg cggagcacgc gcagatcctg tcctcggagc agtacctgcg ggccgcgatg       660
     ctcgagaacg gtcagtatcc cgtgctcgcc cacgaactgg tcgatctgcg cacgaagcaa       720
     ccgttacagc cggggcttcc ggtcaccgtg gccgccgcgt acaccggccg ccccacaccc       780
     tgggcggcgt cctggctacg acagcagcgc ggcctggccg accggttgga tgcacgattc       840
     gccgtgatcg cgccgagcgg ccaccacgtg atggtggaac agcccgccca ggtggcggcg       900
     ctgatcctgg atgcgggcgg cggctag                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page