(data stored in ACNUC1104 zone)

EMBL: CP001966.PE111

CP001966.PE111       Location/Qualifiers
FT   CDS_pept        121306..121866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_3790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76765"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ7"
FT                   /inference="similar to AA sequence:KEGG:MAB_3790"
FT                   /protein_id="ADG76765.1"
FT                   /translation="MAAEDGSGLGLRGQTAGETKPPQCLYTPFGKNFSRASDGSDWNLY
FT                   YAASVGYTGPDGSRVTVTVDRQRVGSDVVALTTSWMSTCGTYDRAFPTFANPQVRNQRV
FT                   TTAFTREQTTSGVQTYRFVASSRSLDDATTGKPLPSGAGVTRVLLARVRSVVFTVEATG
FT                   KIGYADLDAMLATAIANAEAAPR"
     gtggcggctg aagacggttc gggcctcggg ctccgcgggc agacggcggg ggagacgaag        60
     cctccgcagt gcctgtacac gccgttcggc aagaatttct cccgcgcatc cgatggttcc       120
     gactggaatc tgtactacgc agcgagcgtc ggatataccg gtcccgacgg gagccgggtc       180
     acggtcacag tggaccggca gcgggtgggc tcggacgtgg tcgcgctgac caccagctgg       240
     atgtcgacct gcggtaccta cgacagggcc tttcccactt tcgccaatcc gcaggttcgc       300
     aatcagcggg tgaccaccgc gttcacacgg gaacagacga cgagcggcgt gcagacgtat       360
     cgcttcgtcg cgtccagccg gtcgctcgac gatgcgacca cggggaaacc gttgcccagt       420
     ggcgccggcg tgacgcgcgt gctcctggca agggtgcgat ctgtggtctt caccgtggaa       480
     gccaccggaa agatcggcta cgcggatctc gacgcgatgc tggcgacggc gatcgcgaac       540
     gccgaagcgg caccccggtg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page