(data stored in ACNUC1104 zone)

EMBL: CP001966.PE114

CP001966.PE114       Location/Qualifiers
FT   CDS_pept        complement(122979..123470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0114"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="KEGG: mmi:MMAR_5403 ribonuclease activity regulator
FT                   protein RraA; TIGRFAM: regulator of ribonuclease activity
FT                   A; PFAM: Dimethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76768"
FT                   /db_xref="GOA:D5UQ00"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ00"
FT                   /inference="protein motif:TFAM:TIGR01935"
FT                   /protein_id="ADG76768.1"
FT                   /translation="MSDVQFTPTADLVDEIGEEVRSCDTQFRQFGGRRAFAGEVVTVKC
FT                   FQDNALLKSVLGEPGAGRVLVIDGSDENGVPSLHTALVGDIIAELGRGNGWAGIVAYGA
FT                   IRDAAVIGTLDIGVKALGTNPRKSTKTGAGERDVPLSFGGVTFAPGDTLFSDDDGIVLR
FT                   "
     atgagcgacg ttcagttcac ccccaccgca gacctcgtcg atgagatcgg tgaggaggtg        60
     cgcagttgcg atacccagtt ccggcagttc ggcggccgcc gcgccttcgc cggcgaggtg       120
     gtcacggtga agtgcttcca ggacaacgcc ctgctcaagt cggttctcgg cgagcccggc       180
     gcaggccggg tgctggtgat cgacggttcc gatgagaacg gcgtgccgtc gctgcacacc       240
     gcactcgtcg gcgacatcat cgccgagttg ggtcggggca acgggtgggc gggcatcgtc       300
     gcctacggcg cgatccgcga cgccgccgtg atcggcaccc tcgacatcgg tgtgaaggcg       360
     ttgggcacca acccgcgcaa gtccacgaag accggtgccg gcgagcgcga tgtgcccctc       420
     agcttcggcg gggtcacctt cgcgccgggc gatacgcttt tcagcgacga cgacggcatc       480
     gtcctgcgtt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page