(data stored in ACNUC1104 zone)

EMBL: CP001966.PE116

CP001966.PE116       Location/Qualifiers
FT   CDS_pept        125200..125745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76770"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ02"
FT                   /inference="similar to AA sequence:KEGG:MAB_0800"
FT                   /protein_id="ADG76770.1"
FT                   /translation="MDVTFIKRAGGYDVRVRRERGPELAPRGGPGGSPTVPHDAAHLIV
FT                   EIEAGLPGGVYGRIADANGLDGLFWPADPAARRRATRNRKQPSAAQSADMARSEYLASL
FT                   TVALWEVERGLRAPDPAWPGSLDDAEITDELRERIFARYDEFAPRWRALSDGGELTVAW
FT                   PAAAVSGRRPGRKPARRG"
     atggacgtca ccttcatcaa gcgcgccggc gggtacgacg tgcgggtgcg tcgcgagaga        60
     gggccggagc tcgcgccgcg cggcggcccc ggcggcagcc cgacggtgcc gcacgacgcg       120
     gcgcatctga tcgtcgagat cgaggcgggg ctgcccggtg gcgtctacgg ccggatcgcc       180
     gacgccaacg gcctcgacgg cctgttctgg cccgccgacc cggcggcccg gcgtcgggcc       240
     acccggaacc gcaagcagcc cagcgcagcc caatcggccg atatggcgcg gtcggagtac       300
     ctcgcttcgc tcaccgtcgc gctgtgggag gtggagcgag gcctgcgggc gccagatccg       360
     gcgtggccgg gttcgctcga cgatgccgag atcaccgacg aactgcgcga gcggatcttc       420
     gcccgctacg acgaattcgc gccgcggtgg cgcgcgctca gcgatggcgg cgagctgacc       480
     gtcgcctggc ccgcggcggc ggtcagcggc cgacggccgg gccggaagcc cgcacggcgc       540
     gggtga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page