(data stored in ACNUC1104 zone)

EMBL: CP001966.PE118

CP001966.PE118       Location/Qualifiers
FT   CDS_pept        complement(126666..127361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mav:MAV_0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76772"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ04"
FT                   /inference="similar to AA sequence:KEGG:MAV_0179"
FT                   /protein_id="ADG76772.1"
FT                   /translation="MGLFGKKQKSSRAERRAQAKALKSKARLEAKLAAKNTAKSAKRSA
FT                   KNAVKSERGAQKSDVARAKVIARMQGKSDKLNLKIAETNARAAVDGKLLSEARLKRYVS
FT                   TARLLAPVVVPLAYRAAQAGRNKLDSARATRLGVPVDEVAQFAGFGGGLAARVAASRRS
FT                   LDQLATAHPDAETKAFVAAVAQRLDDLSAAITASESMPPARRRPAHQAIARELDGIDAD
FT                   LLNRLGVSS"
     atgggtttgt tcggcaagaa gcagaagtcc tcgcgcgcgg agcgtcgggc gcaggccaag        60
     gcgctcaagt cgaaggcgcg gctcgaggcg aagctggccg cgaagaacac ggcgaagagc       120
     gccaagcgct ccgcgaagaa cgccgtgaag tccgagcgcg gcgcgcagaa gtcggatgtg       180
     gcgcgggcga aagtgatcgc gcggatgcag ggcaagtccg acaagctcaa cctcaagatc       240
     gccgagacga acgcccgcgc ggcggtcgac ggcaagctgc tgtcggaggc gcgactgaag       300
     cgttacgtct cgaccgcacg cctgctggcg cccgtcgtgg tgccgctcgc ctaccgggcc       360
     gcgcaggccg ggcgcaacaa gctcgactcg gcgcgggcca cccggcttgg cgtcccggtc       420
     gacgaggtcg cgcagttcgc cggtttcggc ggcggcttgg ccgcccgggt ggcggcatca       480
     cgccggtccc tggaccagct cgcgaccgca catccggacg ccgagaccaa ggccttcgtc       540
     gcggccgtcg cacagcgcct cgacgatctg tcggcggcga tcaccgcgtc cgagtccatg       600
     ccgcccgccc ggcgccggcc ggcgcatcag gcgatcgcgc gcgagctcga cggcatcgac       660
     gccgatctgc tcaaccgtct cggcgtcagc tcctag                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page