(data stored in ACNUC1104 zone)

EMBL: CP001966.PE120

CP001966.PE120       Location/Qualifiers
FT   CDS_pept        complement(129044..130132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC762216"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76774"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ06"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76774.1"
FT                   /translation="MSAPTHLSARIRAAVIVSLAVGTMAAAPAFAAPDSDSGSGGSSSS
FT                   GSSSVESSSDGKSIHGTSSNGTSFDFSIKDRNKAADGSSKSDKDKGKDGRDSDGSTGGA
FT                   KDDKDKDGKDKDDKGKDKHGLPGIGEILGGIFGGAGGGASSGASSAGGSATGPAGAAAA
FT                   IESPGTGSGGAALEGAGIRSGNPEPQGVGVREGGASAGGAGVRSGNPAPAPASSAGGRS
FT                   VDASPAGAPAVAAPAAPAAPVVAVPVIAPPVLAPPVLVAGPRVAPAAPVPAAAPKPGAG
FT                   DEGKDAADPAAKDQRAADSSRSQPTLLTAAYSSAQRVTPVATETAKQLSPALFAVLGGV
FT                   ALLGSGTFVDSLRRAHLGQAQA"
     gtgtccgctc caacgcacct ctcggcacgt atccgtgccg ccgtgatcgt ctcgctcgcc        60
     gtgggcacga tggcagccgc tccggccttc gccgcacccg attccgactc cggttccggc       120
     ggctcatcgt cgagtggatc ctcctcggtg gagtcgtcgt ccgacggcaa atccatccat       180
     ggcacctcgt ccaacggcac ctccttcgac ttctccatca aggaccggaa caaggccgcc       240
     gacggctcgt cgaagtccga taaggacaag gggaaggacg gccgcgattc cgacggctcg       300
     accggcggcg cgaaggacga caaggacaag gacggcaagg acaaggacga caagggcaag       360
     gacaagcacg gcctgcccgg catcggcgag atcctcggcg gcatcttcgg cggtgccggc       420
     ggcggtgcgt cgtcaggtgc cagttccgcg ggcggcagcg cgaccggtcc ggccggcgcc       480
     gccgccgcca tcgagagccc gggcaccggt tcgggtggcg ccgcgctcga gggcgcgggt       540
     atccgctccg gcaaccccga gccgcagggc gtcggcgtcc gcgagggcgg tgccagcgct       600
     ggcggcgcgg gtgtgcgcag cggcaatccc gcccccgctc cggcgtcctc cgccggcggc       660
     cggtccgtcg acgcgagccc ggcgggcgct cccgccgtgg cggcacccgc agctccggcg       720
     gctcccgtcg tcgcggtccc cgtcatcgcc ccgcccgtac tggccccgcc cgtactggtc       780
     gcgggtccgc gggtagcgcc cgcggcaccg gtgccggccg ccgcaccgaa gcccggcgcc       840
     ggcgacgagg gcaaggacgc cgccgatccc gccgcgaaag atcagcgtgc ggccgactcg       900
     tcgcgctccc agcccacgct tctcaccgcg gcgtactcgt ccgcgcagcg agtcactccg       960
     gtggccaccg agacggccaa gcagctctca cctgccctgt tcgccgtact cggcggtgtg      1020
     gcactgctcg gcagcggcac gttcgtcgat tcgctgcgcc gcgcgcatct gggccaggcc      1080
     caggcctga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page