(data stored in ACNUC1104 zone)

EMBL: CP001966.PE131

CP001966.PE131       Location/Qualifiers
FT   CDS_pept        137586..137936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0131"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: nfa:nfa1230 hypothetical protein; PFAM:
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76785"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ17"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADG76785.1"
FT                   /translation="MMDARGFPTDDGLISIDALPEVATITLLDVREPDEWELGHAPGAL
FT                   HIPLSDLPLRFEEIDLDSDVYVICRGGGRSESAVRYLETVGVEAAVVDGGMIAWAAAAK
FT                   PVVRSDGGPGVV"
     atgatggacg cgcgtggatt cccgaccgac gacgggctga tctcgatcga cgccctcccg        60
     gaggtggcca ccatcaccct gctcgacgtg cgggaacccg atgagtggga gctcgggcac       120
     gcccccggcg ccctgcacat ccccctgtcc gacctgccgc tgcggttcga ggagatcgac       180
     ctcgactccg atgtgtacgt gatctgccgc ggcggcggcc gctccgagag cgccgtccgc       240
     tacctggaaa ccgtcggcgt cgaggccgcg gtcgtcgacg gaggcatgat cgcctgggcc       300
     gcggccgcga aaccggtggt ccgctcggac ggcggcccgg gagtcgtctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page