(data stored in ACNUC1104 zone)

EMBL: CP001966.PE133

CP001966.PE133       Location/Qualifiers
FT   CDS_pept        138757..139515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0133"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: nfa:nfa1250 putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76787"
FT                   /db_xref="GOA:D5UQ19"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ19"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADG76787.1"
FT                   /translation="MAGGVAGIVAHRGASGEYPEHTMSAFEAAVAEGADAIECDVRLTR
FT                   DHHLVCVHDRTVERTSDGTGAVSELDLADLKAMDFGSWKRPGHPEPVVTLDELIDLART
FT                   ADRKLFIETKHPVRFGGLVEQKLLATLQRHGLSRPDDPASAPVTVISFSGSAVWRVRRN
FT                   APGVPAVLLGEASRLLGGGAATAVRAQGIGPSVESLRERPDTVAKARAAGRFTYCWTVD
FT                   TEADVALCHGLGVEWIATNHPARARSWLSG"
     atggctggcg gtgtagcggg gatcgtggcg caccgcggcg ccagcggcga gtacccggaa        60
     cacaccatga gcgccttcga ggcggcggtc gccgagggcg ccgatgcgat cgaatgcgat       120
     gtccggctca cccgcgacca ccacctggtg tgtgtgcacg accgcaccgt cgagcgcact       180
     tccgatggca ccggcgccgt ctccgagctc gacctcgccg atctcaaggc gatggatttc       240
     ggttcgtgga aacggcccgg ccatccggaa ccggtggtca ctctggacga gttgatcgac       300
     ctggcgcgca ccgccgaccg caagctcttc atcgagacca aacaccccgt tcggttcggt       360
     ggcctggtcg agcagaagct gctggccacg ctgcaacggc acgggctgtc ccggcccgac       420
     gatcccgcgt cggcgcccgt caccgtgatc tccttctccg ggtccgcggt gtggcgcgtg       480
     cgccgcaacg cacccggcgt ccccgccgtc ttgctcggcg aggcctcccg gttgctcggc       540
     ggcggtgcgg ccacggcagt gcgcgcccag ggcatcgggc cgtcggtgga atcgctgcgg       600
     gagcggcccg acaccgtggc caaggcgcgt gcagcgggcc ggttcaccta ctgctggacg       660
     gtcgacaccg aggccgacgt ggccctgtgc cacggccttg gagtggagtg gatcgccacc       720
     aatcacccgg cccgcgcccg ctcctggctc tccggctag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page