(data stored in ACNUC1104 zone)

EMBL: CP001966.PE135

CP001966.PE135       Location/Qualifiers
FT   CDS_pept        complement(140423..141076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0135"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: nfa:nfa33150
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76789"
FT                   /db_xref="GOA:D5UQ21"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ21"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76789.1"
FT                   /translation="MTDERGRIGRPPKVNREQVVAAAADILTNDGPLKFSMRALASRLD
FT                   ISAMGIYHYFDSKNDLLGAVLEHQAWNTPVPELSDDPRERLVELPLAVITHLSRHPWVI
FT                   DVLSADEIIDAFSAWAFNEFLLTTDRLGIGEEDSLQLLFGIWRIVVGEVVVRNNIAMRN
FT                   ERPTQPWYEREVPAHVTERERLMQALGNVDDGINAYDVEVTLRAYLVGQLGQPA"
     atgaccgatg agcgcggccg gatcggccgt ccccccaagg tgaaccgcga gcaggtcgtc        60
     gccgcggcag cggacatcct caccaacgat ggtccgctga agttctccat gcgcgccctg       120
     gcatctcgcc tcgacatcag cgcaatgggg atctaccact acttcgactc gaagaacgac       180
     ctgctcgggg cggtattgga gcaccaggcg tggaacacgc cggtacccga actatccgac       240
     gatccccgtg aacggttggt ggaactgcca ctggccgtga tcacccacct ctcccgccat       300
     ccgtgggtga tcgatgtgct ttccgccgac gagatcatcg acgccttctc cgcctgggcc       360
     ttcaacgaat tcctcctcac cacggatcgc ctcggcatcg gcgaggagga ttcgctccag       420
     ctgttgttcg gcatctggcg gatcgtggtc ggtgaggtgg tggtgcgcaa caacatcgcg       480
     atgcgcaacg agcgccccac ccagccgtgg tacgagcgtg aggtgcccgc ccacgtcacc       540
     gaacgcgaac gactgatgca ggccctcggc aacgtcgacg acggcatcaa cgcctacgac       600
     gtggaggtca ccctccgtgc gtatctggtg gggcagctcg gccagccggc ctag             654
//

If you have problems or comments...

PBIL Back to PBIL home page