(data stored in ACNUC1104 zone)

EMBL: CP001966.PE136

CP001966.PE136       Location/Qualifiers
FT   CDS_pept        complement(141087..142487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0136"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="KEGG: nfa:nfa1290 putative transcriptional
FT                   regulator; TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76790"
FT                   /db_xref="GOA:D5UQ22"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ22"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADG76790.1"
FT                   /translation="MNDERRRGDERPLAWSQVPEGEPSVTRRPVGNRQGPPRPQQPGRQ
FT                   PGQRGSGPRPGAGQQPFRPQNPPNPGNQQPRPTRVERPAPQGTWAPPQTPEPIPASTSR
FT                   RAGRVGERGSSGRVPPPPRPPRDRSRRRAAPEAPKPAAPPKVKRKRRIRPLRWLTAFLV
FT                   LVIVGTAAATFYFDGKLTRIDALAAYAGRIADTPGTNWLLVGSDAREGLTPEQQKDLAT
FT                   GGDLGGARTDTIMLVHIPKSGSPLLISIPRDLYVPVPGQGSYKINAAYFLGGPKLLVQT
FT                   FESKAKVRVDHYAEIGFGGFATMVDALGGIEMCPKYPINDPKAGIRLQAGCQNLSGAQA
FT                   LGYVRTRATPNADLDRVVHQREFMTALFTKATSPTTLLNPFEMWSLADATVGALTVDTD
FT                   THLWDLGRLAWALSSSPVTTTTPTGGSSDTDEGNALIWGKNTTEFFSLIAADQPVPDRL
FT                   LSGPGNSG"
     gtgaacgacg aacgacgccg gggcgacgag cgaccgctcg cctggtccca ggtgcccgag        60
     ggggaaccgt cggtgacccg acgccccgtc ggcaaccggc agggcccgcc gcgcccgcag       120
     cagcccggtc ggcaaccggg ccagcgtggg tcggggccac gccccggtgc cggccagcag       180
     cccttccgac cgcagaatcc gccgaacccg ggcaaccagc agcctcgccc cacccgggtc       240
     gagcgccccg ccccgcaggg cacgtgggca ccgccgcaga cccccgaacc gattcccgcg       300
     agcacgagcc gccgcgccgg cagagtgggc gagcgcggca gcagtggccg ggttccgcca       360
     cccccgcgcc ctcctcgcga tcgctcacgc cgcagggcgg caccggaggc gccgaagccc       420
     gccgcaccgc cgaaggtcaa acgcaagcgc cgcatacgtc cgctgcgctg gctcaccgcg       480
     ttcctcgtac tggtgatcgt gggcaccgct gccgcgacct tctacttcga cggcaagctc       540
     acacggatcg acgcgctcgc cgcctatgcg ggccgcatcg ccgacacccc cggcaccaac       600
     tggctgctgg tcggctcgga tgctcgtgag ggactcacgc ccgaacagca gaaggacctg       660
     gccaccggcg gcgacctcgg gggcgcccgc accgacacca tcatgctggt gcacatcccc       720
     aagtccggtt ccccgctgct gatctcgatc ccccgcgatc tgtacgtacc ggtcccgggc       780
     caaggcagct acaagatcaa cgccgcctac ttcctcggcg gcccgaagct gttggtgcag       840
     accttcgaat cgaaggcgaa ggtgcgcgtc gaccactacg cggagatcgg tttcggcggc       900
     ttcgcgacca tggtcgatgc gctgggcggc atcgagatgt gcccgaagta cccgatcaac       960
     gaccccaagg ccgggatccg gctgcaggcc ggctgccaga acctcagcgg tgcgcaggcg      1020
     ctcggctacg tgcgcacccg tgccaccccc aacgccgacc tcgaccgtgt ggtgcatcaa      1080
     cgcgagttca tgaccgcctt gttcaccaag gcgacctcgc cgacgacgct gctcaacccg      1140
     ttcgagatgt ggagcctggc ggatgcgacg gtgggcgcgc tcaccgtcga caccgacacc      1200
     cacctgtggg atctggggcg gctggcatgg gcactgagca gctctccggt aacgaccacc      1260
     acccccaccg gcggcagcag cgacaccgac gagggcaatg ccctcatctg ggggaagaac      1320
     accacggagt tcttcagcct gatcgccgcc gaccagccgg ttcccgaccg actcctcagc      1380
     gggcctggga attccggata a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page