(data stored in ACNUC1104 zone)

EMBL: CP001966.PE137

CP001966.PE137       Location/Qualifiers
FT   CDS_pept        complement(142577..143356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0137"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   mgi:Mflv_2806 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76791"
FT                   /db_xref="GOA:D5UQ23"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ23"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADG76791.1"
FT                   /translation="MSAPEPVPASEKTPLRAEVLIVLLVTFGWSGMYSLIRLIGYQLGP
FT                   GVGGTTVSLNPSRSPHIPIDFLLQTLTAVQLFAWASLALYLLWRSGIGFADLGFALRGS
FT                   RRELLRNIGLGTGLAALIGLPGLVLYVAGRTLGVTANVLPAAGGDPGWRMVTYVLIAAG
FT                   NAVAEEVVVVGYFMTRLRQLGVGRAGTVAASALLRGSYHLYQGFGAGLGNVVMGVVFGA
FT                   AYDRWRRLWPLVIAHFVIDVVAYLGYALLKDHLGFLR"
     gtgagcgccc ccgaacccgt tcccgcgagc gagaagacac cgctgcgcgc ggaggtgctg        60
     atcgttctgc tcgtgacttt cggctggtcg gggatgtatt cgctgatccg gctgatcggc       120
     taccaactcg gcccgggggt gggcggtacg acggtgagcc tcaatccttc gcggagcccg       180
     cacatcccga tcgatttcct gctccagacg ctcaccgccg tgcagttgtt cgcgtgggcc       240
     tcgctcgccc tgtacctgct gtggcgttcg gggatcgggt tcgccgacct cggcttcgcg       300
     ctgcgcggct cgcgtcgcga gttgctcagg aacatcggtc tgggcaccgg cctggccgcc       360
     ctcatcgggc tccccggcct cgtcctctac gtggccggac ggacgctggg cgtgaccgcg       420
     aacgtgctcc cggccgcggg cggggatccg ggctggcgga tggtgaccta cgtcctcatc       480
     gcggcgggga acgccgtcgc cgaggaggtc gtggtggtgg gctacttcat gacccggctg       540
     cggcagctcg gcgtggggcg cgcgggcacg gtcgccgcat ccgcgctgct ccgcggcagc       600
     taccacctct accagggctt cggtgcgggc ctgggcaatg tggtgatggg tgtggtcttc       660
     ggtgccgcct acgaccggtg gcgcagactg tggccactgg tcatcgcgca tttcgtgatc       720
     gatgtggtgg cctatctcgg ctatgcactg ctcaaggacc acctcggctt cctgcgctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page