(data stored in ACNUC1104 zone)

EMBL: CP001966.PE139

CP001966.PE139       Location/Qualifiers
FT   CDS_pept        complement(144880..145698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_1432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76793"
FT                   /db_xref="GOA:D5UQ25"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76793.1"
FT                   /translation="MSATPDDPTPQQHEGEPKPDLASRTKAHVGDVTTRARTHADDAAT
FT                   RAKTKAGDAASRAGEAAKRWLRRAIVAAIVVAVLVAAYFALAAYLPRKWADLLVGWVGT
FT                   DGGTLKGTVFGLGIGFLCAGLPLLLLWFAAKRAANHPKIATVLGLIAVIATVPNLMTLA
FT                   VAIGTGSGASYARTKIDQNAAGFRWATLIGVVIGVIAAIALAIFLEVQRRKRAKKKQQK
FT                   ALEKEAKAAQKQAEKDAKAAEKALKSGHAASSLDDEPSAPSGGGTGPSGT"
     atgagcgcca caccggacga ccccacgcct cagcagcacg agggcgagcc gaagcccgac        60
     ctcgcctcgc gtacgaaagc ccacgtcggc gacgtgacca cccgcgccag gacacacgcc       120
     gacgatgcgg ccacccgcgc caagaccaag gccggtgatg cggcatcccg cgccggtgag       180
     gcggcgaagc ggtggctgcg ccgcgcgatc gtcgccgcca ttgtggtcgc ggtcctcgtc       240
     gccgcctact tcgcgctcgc cgcgtacctg ccccgcaagt gggcagatct cttggtcggc       300
     tgggtcggca ccgacggcgg cactctcaag ggcaccgtct tcgggctggg catcggcttc       360
     ctctgcgccg ggctccccct gctcctgctg tggttcgccg ccaagcgggc ggcgaaccac       420
     ccgaagatcg ccaccgtgct gggcctcatc gcagtgatcg cgaccgtccc caatctcatg       480
     accctcgccg tcgcgatcgg taccggcagc ggtgccagct acgcgcgcac caagatcgac       540
     cagaacgccg ccggattccg gtgggccacc ctgatcggtg tcgtgatcgg tgtgatcgcc       600
     gcgatcgcgc tcgcgatctt cctcgaggtg cagcgccgta agcgagcgaa gaagaagcag       660
     cagaaggcgc tggagaagga agccaaggcc gctcagaagc aggcggaaaa ggacgccaag       720
     gctgccgaga aggcgctcaa gagcggccac gcagcgtcca gcctcgacga tgagccgtcc       780
     gcaccgtccg gcggcggtac cggcccgagc ggcacctag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page