(data stored in ACNUC1104 zone)

EMBL: CP001966.PE14

CP001966.PE14        Location/Qualifiers
FT   CDS_pept        16946..17272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76668"
FT                   /db_xref="GOA:D5UPB6"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76668.1"
FT                   /translation="MSTWDIARAVVAAGCALLAFRQFGIGFRAACECDEVFGDEYRALR
FT                   RTYWRSGGYLVLWAGAAGLVGFNPAIGAGFALMMGPLLVANAFQMTDFLQPVEIHEAKR
FT                   PKDD"
     atgtcgacgt gggacatcgc gcgggccgtc gtcgccgccg gctgcgctct gctcgcattc        60
     cggcagttcg gcatcggttt ccgtgccgcc tgcgagtgcg atgaggtgtt cggagacgaa       120
     taccgcgccc tgcgccggac ctactggcgc agcggcggct acctggtcct gtgggccggt       180
     gccgccggac tcgtgggctt caatcccgcc atcggggcag gcttcgccct catgatgggg       240
     ccactcctgg tggcgaacgc cttccagatg acggacttcc tgcagccagt cgagattcac       300
     gaggcgaagc gacccaagga cgactga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page